KEGG   Pantoea ananatis LMG 20103: PANA_1057Help
Entry
PANA_1057         CDS       T01195                                 

Gene name
cysS
Definition
(GenBank) CysS
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pam00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PANA_1057 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pam01007]
    PANA_1057 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pam03016]
    PANA_1057 (cysS)
Enzymes [BR:pam01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     PANA_1057 (cysS)
Amino acid related enzymes [BR:pam01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   PANA_1057 (cysS)
Transfer RNA biogenesis [BR:pam03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PANA_1057 (cysS)
 Prokaryotic type
    PANA_1057 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f Mut7-C tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADD76224
UniProt: D4GLV4
Position
1208874..1210187
Genome map
AA seq 437 aa AA seqDB search
MYVCGITVYDLCHIGHGRTFVAFDVVSRYLRYVGFDVNYVRNITDIDDKIIKRANENGES
IETLTNRMIAEMHSDFDALGILPPDREPRATRHIPEIVELVEKLIARGHAYVAENGDVMF
DVLSDVDYGALSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKADEPSWPSPWGQGRPG
WHIECSAMNCKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDR
EKMSKSLNNFFTVRDVLQHYDAETVRYFLMSGHYRSQLNYGEDNLNQARAALERLYTALR
HTDRNAVADGGEAFEARFREAMDDDFNTPEAYSVLFDMAREVNRLKGEDMTAANALAAKL
REIANVLGILQQEPEVFLQSSAQGNDEEVAEIERWVKARADARAAKDWAQADVARDKLNA
LGVIVEDGPQGSSWRRK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtctgcggcatcacggtgtatgacctctgtcacattgggcacgggcgcacgttt
gtggcgtttgatgtggtatcgcgctatctgcgttacgtcggttttgacgtaaattacgtg
cgcaatattaccgatatcgacgacaaaattatcaagcgtgccaacgagaacggcgagagc
atcgaaaccctgaccaatcgcatgattgccgagatgcacagcgattttgatgcgctgggc
attttgccgccagatcgggaaccgcgcgccacgcgccatattccggaaatcgtcgagctg
gtggaaaagctgattgcccgcggtcatgcctatgtggcggaaaacggcgatgtcatgttt
gatgtgctgagcgatgtggattacggtgcgctgtcgcgtcaggatctggaccagcttcag
gccggcgcccgcgttgaagtggcggatgtgaagcgtaatcccatggatttcgtgctgtgg
aagatgtctaaagcggacgaaccctcatggccttcaccgtggggccaggggcgcccaggc
tggcatattgagtgttcagccatgaactgcaaacagcttggcgcgcatttcgacatccac
ggcggcggatctgacctgatgttcccacatcatgaaaacgaaatcgcccagtctacctgc
gcccatgatggtccctatgtgaactactggatgcattcaggcatggtgatgatcgatcgt
gagaagatgtcgaagtcgctgaataactttttcaccgtgcgcgacgtactgcagcattat
gatgccgaaaccgtgcgctatttcctgatgtccggccactatcgtagccagcttaactat
ggcgaagataacctgaaccaggcacgtgcggcgctggaacgtctttataccgcgctgcga
cataccgatcgcaacgcggttgccgacggcggtgaagccttcgaggcccgtttccgcgag
gcgatggacgatgattttaacactccggaagcctattccgtgctgttcgacatggcgcgt
gaagtgaaccgtctcaaaggcgaagacatgacggcagccaatgcgctggcggcaaagcta
cgtgaaattgccaacgtgctgggcattctgcagcaggagccagaagtgtttctgcaaagc
agtgcgcagggcaacgatgaagaagtggcagaaatcgaacgctgggtgaaagcccgtgcc
gacgcacgcgcggcaaaagactgggcgcaggctgatgtagcccgcgacaagctgaacgcg
cttggcgtgattgtcgaagatggccctcagggctccagctggcgacgtaaataa

DBGET integrated database retrieval system