KEGG   Pantoea ananatis LMG 20103: PANA_1076
Entry
PANA_1076         CDS       T01195                                 

Gene name
rhsD
Definition
(GenBank) RhsD
Organism
pam  Pantoea ananatis LMG 20103
SSDB
Motif
Pfam: RHS_repeat Tox-HNH-EHHH PAAR_motif RHS DUF4595
Other DBs
NCBI-ProteinID: ADD76243
UniProt: D4GLX3
Position
complement(1226493..1230686)
AA seq 1397 aa
MFEAARLGDDIGHSHALAGMIAGTIVGGLIAAAGGIAAGALMIAGIGASCLGVGVLLVGL
SIGVGYLTGELATAARDGIADAGAASMTPKGKITTGSPNVFINSKPAAMATNSIVACKDD
GPQQMAEGSSRVYINGLPASRIDDRTTCDAKVMTGSDNVYIGGEPEQTLPIQPEVPEWVY
KASDLTLLFAGLAGGVGGAAGKVGALGKLLSKIPGINKIARVACRAGALMTGVAAAGILA
RPVDIVSGQKFLSGDDELDFVLPSRLPLRWQRYWRSGNPGDSVLGRGWNLFWETRLERYQ
DGLVWRAPSGDYVSFPLVPKGQRTYCEAEKHWLEHHRDDSWSLYDISGERWHFMPLRDDA
PSLPLCLTEPCGNEIQFDWNSDHTLAALTDSAGQRVTCRYANNRLAGAWLDDDICLVSYA
YDDIGQLVTVTGRGGSVRRRFQWCDGLMVAHEDMNGLLSEYRWQEIDGLPRVVAFRHSGG
EQLDFEYDFDNGIRRARRDDGVEAHWLIDDDDHVARFTDFDGRQTMLVYCAGELCDVIMP
GGAMRCSNWDRYGRMTQEIDPVGRRTTYHWFRMTDRVIRTDYPDLSATQAAYDLNVRLLT
ETDALNNVTTYHYPDDTELLPDSITDATGGVVKLEWNRQGLLTQRTDCSGSVTTFSYDRF
GQLVRSVDAEGHVTQREWNDKGQLCAIIHPDGSRETLHWNTQGQLSAWRDPLETEVRWTY
NALGLPVSLTDRIGRTRRWHYDARGNLLRLENGNGGDYRFTCDPLGRPLSEIRPDKTSRN
MEWNARGFLIGLQENGQPANDGGIARRWQRFSYDDSGLITQRTTQHAEYHYRRHRSGQLA
SLVRTPTSDGMALGIEDDEIAFTYDVAGQLLTEAGINGKLDYEWDALGNLTHLTLPGEQQ
LAWLHYGSGHVSAIRFNQQLVSEFTRDRLHREIRRSQGAREQARQYDSLGRRTMQRSELH
SEVVLPEKAILERAFRYSARSELESVSDTLRGDIIYGYDDEGRLLKHYEARQGHSTSHFT
YDNADNLAANDDALHALPVTDNRVHHWQNLFMKYDDWGNLVSRRSGLHEQHFTYDAENRL
ISAKGNGPDGGFTAHYHYDALGRRTCKVVSTQHDRKEVRFLWQGYRLLQEQQDNGQCQTY
VYDPNEAWSPLARIDHMAAGGRGDVLWFNTDINGAPLEVTDERGNIRWSGQYGSFGEVRR
QTEGFTRLAKQSALPHQPLRYAGQYADSETGLHYNLFRYYDPQVGRFTVQDPIGLEGGWN
LYQYAPNPLSWVDPLGLSNCGAPNKKTSYEGISRRDAFRQAKRDAGIPMNQHPSSITRPD
LLDGSGKKILDSTGQPIKTRQYEFVDKRGQSVFLQEHSLGHTKATSGHGAEPHFNLRPLD
NLNTGSVPGTHGHYNFP
NT seq 4194 nt   +upstreamnt  +downstreamnt
atgtttgaagctgcacgcctcggcgatgatatcggtcactctcatgccctggcgggcatg
attgcaggcactatcgtcggtggactgatcgctgcggcgggcggtattgctgcgggtgca
ttgatgattgccgggataggcgcctcctgccttggcgtgggcgtattgctggttggactc
agtatcggcgtgggttaccttactggcgaactggccaccgccgcgcgagacggaatagcg
gatgctggggcggccagcatgaccccaaagggcaagattaccaccggttcgcccaacgtc
tttattaacagtaaacccgccgccatggccaccaacagcatagtggcatgcaaggacgat
ggtccgcagcagatggcagaaggctcctcccgggtgtacatcaacggcctgcctgcatca
cgcattgacgatcgcaccacctgcgatgccaaagtgatgacgggttctgacaacgtctat
atcggcggcgagcctgaacaaacgctgcctatccaacctgaagtgcccgaatgggtttat
aaagcctccgatcttaccctgctgtttgccgggctggccggtggcgtgggcggtgcggct
ggcaaggtcggcgcgctgggtaaattactgagcaagattcccggcatcaataaaatcgcc
cgggtggcctgccgtgctggtgccttaatgaccggtgtggcggccgcaggtattcttgcc
cgtcccgttgatatcgtaagcggccagaagtttcttagcggcgatgatgaactggatttt
gtgctgccctcccggctgccgctacgctggcagcgctactggcgcagcggtaatcccggc
gacagcgtattaggccgtggctggaacctgttctgggaaacacggctggaacgctaccag
gatgggctggtctggcgtgcgccctccggcgattacgtctcttttcctctggtgcccaaa
ggccagcgtacctactgcgaagcggagaaacactggctggaacatcatcgggacgacagt
tggtcattgtatgacatcagcggtgagcgctggcattttatgcccctgcgcgatgatgcc
ccttctcttcccctctgcctgaccgagccctgcggcaatgagattcagttcgactggaac
tccgatcacacattggccgcgctgacagacagtgccggtcagcgcgtaacctgccgctat
gcgaataaccggctcgcaggtgcctggctggatgacgatatttgtctggtcagttacgct
tatgatgatatcggccaactcgttacggtaacgggccggggcggtagcgtgcgccgacgc
ttccagtggtgcgatggcctgatggtcgcccatgaagatatgaatggcctgctaagtgag
tatcgctggcaggagatcgatggcctcccaagagtggtggccttccgtcacagcggcggc
gagcagctggattttgagtacgattttgataatggcatccgacgcgcgcgacgtgatgac
ggcgttgaagctcactggctcattgacgatgacgatcatgtcgcccgcttcaccgacttc
gacggccgccagaccatgctggtttactgcgcaggcgagttgtgcgatgtgattatgccc
ggcggcgccatgcgctgcagcaactgggaccgctatggtcgcatgacgcaggagatcgat
ccggtcggacgtcgaaccacttatcactggttccgcatgactgaccgtgtgatccgtacg
gactatcccgatctgagcgcgactcaggcggcttacgatcttaatgttcgcctgctgact
gaaaccgatgcgctcaataacgtcaccacctatcactaccctgatgacacagaactgctg
ccagacagcatcaccgatgcaacgggcggcgtggtgaagctggaatggaaccgacaaggg
ctgctgacgcagcgcaccgactgctctggcagcgtaacgacgtttagctacgaccgattt
ggccagcttgttcgcagcgtggatgctgaaggtcatgtcacccagcgcgagtggaatgac
aagggacaactctgcgccattatccatccagacggcagccgggaaaccctgcactggaac
acccaggggcagctcagtgcgtggcgcgatccgctggagaccgaagtccgctggacctat
aacgcactcggattaccggtgagcctgacggaccgcattggtcgcacgcgtcgctggcat
tacgatgcccgtggtaatctgctgcggctggaaaacggcaacggcggtgactatcgcttt
acctgcgatccgctcggccgtccattgagtgagatccggcccgataagacctcacgcaat
atggaatggaatgctcgtggttttctcattggtttacaggaaaatggccagcccgctaat
gacggtggcatagcccgacgctggcagcgctttagctacgacgacagcggcttgattacc
cagcgcacaacgcagcatgcagaataccactaccggcgtcatcgtagcggtcaacttgcc
agcctggttcgcacgccgaccagtgacggaatggcgcttggtatcgaagacgatgaaatc
gcctttacctatgacgtcgcaggtcagctcttaacagaagccggtataaacgggaaactg
gattacgaatgggatgcactgggcaacctcacccatctgaccctgccgggtgaacagcaa
cttgcctggctgcactacggttcgggtcacgtcagcgcgattcgctttaatcagcaactg
gtcagtgaatttacccgcgaccgcctgcaccgggaaattcgtcgcagtcagggcgcgcgt
gagcaggcgcgtcagtacgacagccttggcaggcgtacgatgcagcgcagtgaattgcat
agcgaggtggtgctaccggaaaaagccattctggaacgcgctttccgctattcggcgcgc
agtgaactggagtctgtcagtgatacgctgcgcggcgacattatctatggttacgatgat
gaaggccgcctgctgaagcactacgaagccagacagggccacagcacctcgcattttact
tacgataatgcggacaacctggccgccaacgacgatgcactgcacgcgttgccggttacc
gacaatcgagtgcatcactggcagaacctgtttatgaagtacgatgactggggcaacctg
gtcagtcgacgcagcggcctgcatgagcagcattttacctatgacgccgaaaaccggctc
atcagcgccaaaggcaatggcccggacggcgggtttaccgcgcattatcattatgatgcg
ctgggcaggcgcacctgcaaagtggtcagcacccagcacgatcgtaaagaagtccgtttt
ctgtggcagggctatcgcctgttacaggagcaacaggataatggccagtgccagacctat
gtgtacgatcccaacgaggcctggagcccgctggcgcgcatcgaccatatggcagcaggc
ggccggggcgatgtgctgtggtttaacaccgatattaacggggcaccgctagaggtgacc
gatgaacggggcaatatccgctggagcggtcagtacggcagctttggcgaggtacgccga
cagacggagggctttacccggctggcaaaacagtctgccctgccccatcagccgctgcgc
tatgcgggccagtatgcggacagcgaaaccggtctacactacaatctgtttcgctattac
gatccgcaggtgggacggtttacggttcaggacccgatagggctggaaggcggctggaac
ctttatcagtatgcgccgaacccgctgagctgggtggatccgctggggttgagtaattgc
ggtgctccaaacaaaaagacatcttatgaaggtatcagtcgcagagatgcgtttaggcaa
gctaaaagggatgctggaataccaatgaatcaacatcctagctctatcacaagacccgac
ttactagatgggagtggtaaaaaaatattagatagtactgggcagccaataaaaactagg
caatacgaatttgttgacaaaagaggtcagtccgtctttctacaagaacatagtttagga
cataccaaggctacttctggtcatggagctgaacctcattttaatcttaggcctcttgac
aacttgaataccggttcagttcctggtactcatggtcactataatttcccataa

DBGET integrated database retrieval system