KEGG   Pantoea ananatis LMG 20103: PANA_1143Help
Entry
PANA_1143         CDS       T01195                                 

Gene name
asnB
Definition
(GenBank) AsnB
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00250  Alanine, aspartate and glutamate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA_1143 (asnB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pam01002]
    PANA_1143 (asnB)
Enzymes [BR:pam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PANA_1143 (asnB)
Peptidases and inhibitors [BR:pam01002]
 Cysteine peptidases
  Family C44
   PANA_1143 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ADD76310
UniProt: D4GMH5
Position
complement(1302509..1304176)
Genome map
AA seq 555 aa AA seqDB search
MCSIFGVLDLKSDPVELRKKALESSRLMRHRGPDWSGVYADDHAILAHERLSIVDVNNGA
QPLYNADHTHVLAVNGEIYNHQALRAKLSDRYAFQTGSDCEVILALYQEKGVDFLDELEG
MFAFILYDSVKGTYLIGRDHIGIIPLYMGNDEHGNLFVASEMKALVPVCRSIKEFPPGSY
LSSTDGEIRRYWQRDWMEYQNVENNVTDAAELKHALEESVKSHLMSDVPYGVLLSGGLDS
SIISAVTKRFAAKRVEDQDKSDAWWPQLHSFAVGLEGSPDLKAAKLVAEHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVFGGYLY
FHKAPNAKEFHEENVRKLLALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGSNGKMEKHILRECFSSYLPESVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLA
TAHFRFPYNTPGSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKNMD
DPSGRAVGVHQSAYK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggtgtgctggatctgaaaagcgatcccgttgagttacgtaaaaaa
gcattggaaagctcacgtttgatgcgtcaccgtgggccggactggtcaggcgtttacgcc
gatgaccacgccattcttgctcatgagcgcctctcaattgttgacgtgaacaacggtgca
cagccgctgtataacgctgaccacacccacgtactggcagtcaatggtgagatctacaac
catcaggccctgcgcgcaaaattaagcgatcgctacgcgtttcagaccggttctgactgc
gaagtgattctggcgctgtaccaggagaaaggtgtcgattttcttgacgaactggaaggc
atgtttgccttcatcctgtatgacagcgtcaaaggcacctatctgattggccgtgaccat
atcggtatcatcccgctgtatatgggcaacgatgagcacggtaacctgtttgtcgcctca
gaaatgaaagcgctggtgccagtgtgccgttcaatcaaagaattcccgccgggaagctac
ctttccagcaccgacggtgaaattcgtcgttactggcagcgtgactggatggaataccag
aacgttgagaacaacgtgactgacgcagcagaactgaaacatgcgctggaagagtcagtg
aaaagccacctgatgtccgatgttccgtatggcgtgctgctgtctggtggtctggactcg
tcaattatttcagcggtaaccaaacgtttcgcggccaaacgcgtggaagatcaggataaa
agtgacgcctggtggccacagctgcactcgttcgcggtcggtctggaaggatcgccggat
ctgaaagcggccaaactggtggcagagcatctgggtacggtgcaccacgaaattcacttc
acggtgcaggaaggcctggatgcgattcgtgacgtgatctaccacattgaaacctatgat
gtgaccacgattcgcgcctccacgccgatgtacctgatgtcgcgtaagattaaagccatg
ggcatcaaaatggtgctgtcgggcgaaggggctgacgaagtctttggtggttatctgtat
ttccataaggcgccaaacgcgaaagagttccatgaggagaacgttcgcaaactgctggcc
ctgcacatgtttgactgcgcacgcgccaacaaagcgatgtctgcctggggcgttgaagca
cgcgtgccgttcctggataagaaattcctggatgtcgccatgcgtatcaacccacaagac
aagatgtgcggtagcaacggtaaaatggaaaaacacattctgcgtgaatgcttctcctct
tacctgcccgaaagcgtggcctggcgccagaaagagcagttctctgacggcgtgggttac
agctggattgacacactgaaagaagtcgcggccaaacaaatcagcgatcagcaactggcg
acggcgcacttccgtttcccgtataacacgccggggtcgaaagaagcgtatttgtaccgt
gaaatctttgaagaactcttcccactgccgagcgctgcagagtgcgtaccaggcgggccg
tctgttgcctgttcatcggcaaaagccatcgagtgggacgaagcctttaaaaacatggat
gacccgtcaggacgtgccgtaggcgttcaccagtctgcctacaaataa

KEGG   Pantoea ananatis LMG 20103: PANA_1295Help
Entry
PANA_1295         CDS       T01195                                 

Gene name
ybiK
Definition
(GenBank) YbiK
  KO
K13051  L-asparaginase / beta-aspartyl-peptidase [EC:3.5.1.1 3.4.19.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00250  Alanine, aspartate and glutamate metabolism
pam00460  Cyanoamino acid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA_1295 (ybiK)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PANA_1295 (ybiK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pam01002]
    PANA_1295 (ybiK)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     PANA_1295 (ybiK)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     PANA_1295 (ybiK)
Peptidases and inhibitors [BR:pam01002]
 Threonine peptidases
  Family T2
   PANA_1295 (ybiK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase_2 PCP_red
Motif
Other DBs
NCBI-ProteinID: ADD76462
UniProt: D4GNB1
Position
1465202..1466161
Genome map
AA seq 319 aa AA seqDB search
MAKAAIAIHGGAGAITRAAMSAEKEQAYRQALYDIVTHGQSMLAQGASALDTVTEAVRRL
EECPLFNAGKGAVFTRQGTHELDACIMDGRTLQAGAVAGVSRIRNPVLAARALLENSPHV
LLAGEGAEAFARAQGLEQVEPDFFSTPERWEQLQRALGSDTALLDHDGAAQGGDPLDPDR
KFGTVGAVALDNDGNLAAATSTGGMTNKQVGRIGDSPLPGAGCYASNDSVAVSCTGTGEV
FIRTLAAYDVAAQMRYGGRTLQQASVNVIHDSVLELGGSGGLIAVDREGNVALPFNSEGM
YRAYARTDEAAEVAIYRES
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcagcgatcgccattcatggcggtgcgggggcaattacccgcgccgccatg
agcgcagaaaaagagcaggcataccgacaggcgctttacgacattgtgacgcacgggcag
agcatgctggctcagggggcttctgcgctggatacggtgactgaggcggtgcgcaggctt
gaggagtgcccgttattcaatgcaggtaaaggcgcggtgtttacgcggcagggcacacat
gaactggatgcctgcatcatggatggccggacgttacaggccggcgcagtggcgggcgta
tcgcgtatacgcaatccggtgctggcggcccgcgcgctattggaaaacagcccgcacgtg
ttgttggcgggcgagggcgctgaagcgtttgcccgggcacaaggccttgagcaggttgaa
cctgatttcttttctacgcctgaacgttgggagcaactgcagcgcgcgctcggcagcgat
accgcgctgttggaccatgatggtgcggcccagggcggcgatccccttgatccggaccgt
aagttcggcacggtgggcgcggttgcgctggacaacgacggcaatctcgccgccgccacc
tctaccggcgggatgaccaataaacaggttggccgcattggcgactcgcccttacccggt
gcgggttgctatgccagcaacgacagcgttgcggtgtcctgtaccggtaccggagaagtg
tttatccgcacgctggccgcttacgatgtggcggcgcagatgcgctacggtggacgcacg
ttacaacaggccagcgtgaatgttattcacgacagcgtgctggagttaggcggcagcggc
gggctgattgcggttgatcgtgagggcaacgtcgcgctgcctttcaacagcgaaggcatg
taccgggcttatgcccgcacagatgaggccgcagaggtggcaatttaccgtgaaagctaa

KEGG   Pantoea ananatis LMG 20103: PANA_2105Help
Entry
PANA_2105         CDS       T01195                                 

Gene name
ansA
Definition
(GenBank) AnsA
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00250  Alanine, aspartate and glutamate metabolism
pam00460  Cyanoamino acid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA_2105 (ansA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PANA_2105 (ansA)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     PANA_2105 (ansA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase Asparaginase_C
Motif
Other DBs
NCBI-ProteinID: ADD77272
UniProt: D4GG21
Position
2353582..2354595
Genome map
AA seq 337 aa AA seqDB search
MQKKNIYVAYTGGTIGMQRSAQGYIPVSGHLQQELAKMPEFHRPEMPDFTIHEYQPLIDS
SDMTPQDWQSIAEDIRRNYDRYDGFVILHGTDTMAFTASALSFMLENLAKPVIVTGSQIP
LAELRSDGQQNLLNSLYVAANYPVNEVTLFFNNTLYRGNRTTKAHADGFNAFASPNLSAL
LEAGIHIRRLNTPPAPQGKGELIVHTITPQPIGVVTIYPGISADVVRNFLRQPVKALILR
SYGVGNAPQNAEFLSELQQASERGIVVVNLTQCISGKVNMGGYATGNALEHAGVISGFDL
TVEAALTKLHYLLSQDLSSEQIRAKMQQNLRGELTED
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaaaaacatttacgttgcctatacgggcggtactatcggtatgcaacgttcc
gctcaaggttatattccggtttcaggtcacctgcagcaagagctggcaaaaatgccggaa
ttccatcgcccggaaatgcctgactttacgattcacgaatatcagcccctgatcgactcg
tccgatatgacgcctcaggactggcagtcaattgccgaagatatccggcgtaattacgat
cgctacgacggttttgtgattctgcatggcacagataccatggcttttaccgcctccgcc
ctgtcgtttatgttggagaacctggccaagcctgtcatcgtaaccggctcgcaaatcccc
ctggcagaactgcgctcggacggtcagcaaaacctgctaaattcactctatgtcgccgct
aactatccggttaatgaagtgacgctgtttttcaataacacgctctatcgcggtaaccgc
accacaaaagcgcatgctgacgggtttaatgcctttgcctcacccaacctttctgcgctg
ctggaagccggcatccacattcgtcgtctgaacacgccacccgcgccacaggggaaaggt
gaactcatcgttcataccattacgccacagcctattggcgtggttaccatttaccccggt
atttccgccgatgtggtgcgcaacttcctgcgccagccggttaaagcccttattctgcgc
tcttatggcgtgggtaatgcgccgcagaacgctgagtttctctctgaactgcagcaggcc
agcgagcgcggcattgtggtcgttaacctgacgcagtgtatttccggcaaagttaacatg
ggcggctacgcgacgggcaatgcgctggagcatgcaggcgtgatcagcggttttgatctg
acggtagaagcggccctgaccaaacttcactatctgttaagtcaggatctttcaagcgag
caaatccgtgccaaaatgcagcaaaacctgcgtggcgaactgacagaagactaa

DBGET integrated database retrieval system