KEGG   Pantoea ananatis LMG 20103: PANA_1199Help
Entry
PANA_1199         CDS       T01195                                 

Gene name
aroG
Definition
(GenBank) AroG
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
pam02024  Quorum sensing
Module
pam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_1199 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PANA_1199 (aroG)
Enzymes [BR:pam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     PANA_1199 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ADD76366
UniProt: D4GMN1
Position
1362690..1363859
Genome map
AA seq 389 aa AA seqDB search
MQISRIHYALIRNLHPVRFGLHWLGCVRRAPGQKLYGMSMNYQNDDLRIKEIKELLPPVA
LLEKFPATERAAQTVSQARQAIHQILTGQDDRLLVVIGPCSIHDTEAAQEYAARLLTLRE
QLKGELEVVMRVYFEKPRTTVGWKGLINDPYMDGSFQLNDGLRLARKLLLEINDSGLPAA
GEFLDMITPQYVADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAIN
AAGSPHCFLSVTKYGHSAIVETRGNGDCHIILRGGKEPNYSASHVSAVKAGLEKAGLPQQ
VMIDFSHANSSKQFQKQMQVADDVAQQMINGERGIIGVMIESHLVEGNQSLESGEPLVYG
KSVTDACIGWADTEKVLRQLADAVIKRRR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttcacgcatacattatgcgctcatcaggaatttacaccctgtgcgcttcggg
ctacattggctgggttgtgtccggcgggcgccgggccagaaattatatggaatgagtatg
aattaccagaacgatgacttacgcatcaaagagatcaaagagctcctgccccccgtagcc
ttactggaaaaatttcctgccaccgaacgtgcagcgcagaccgtgtctcaggctcgccag
gccattcaccagattctgaccggccaggacgatcgcctgctggtggtcattgggccctgc
tcaattcacgatacggaagccgcacaagagtacgcggcgcgcctgttaaccctgcgtgag
cagcttaaaggcgagctggaagtggtcatgcgcgtttattttgaaaaaccgcgtaccacc
gttggctggaaagggctgatcaacgacccttacatggatggctcctttcagctaaacgac
ggcctgcgcctggcgcgtaagctgctgctggagatcaacgattccggcctgcctgccgct
ggcgaattcctggatatgattacgccgcagtacgtggcggatttgatgagctggggggcc
atcggtgcccgtaccaccgagtcacaggttcaccgcgagctggcttccggcctttcctgc
ccggtagggtttaaaaacggtacggacggcaccattaaagtggcgattgatgccatcaac
gcagccggttcaccgcactgtttcctgtcagtgaccaaatacggtcactccgcgattgtg
gaaacccgcggtaacggcgactgccatatcatcctgcgcggcggtaaagagccgaactac
agcgccagtcatgtcagcgcggtgaaagccggtctggaaaaagccgggttgcctcagcag
gtaatgatcgacttcagccatgctaacagcagcaagcagtttcagaagcagatgcaggtg
gcggacgatgtggcacagcagatgatcaacggtgagcgcggtattatcggcgtgatgatt
gaaagccatctggttgaagggaatcagagcctggaaagcggcgagccgctggtctatggc
aagagcgtcacggatgcctgtattggctgggccgataccgaaaaggtgctgcgtcagctg
gccgatgcggttataaagcgtcgcaggtaa

KEGG   Pantoea ananatis LMG 20103: PANA_1708Help
Entry
PANA_1708         CDS       T01195                                 

Gene name
aroH
Definition
(GenBank) AroH
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
pam02024  Quorum sensing
Module
pam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_1708 (aroH)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PANA_1708 (aroH)
Enzymes [BR:pam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     PANA_1708 (aroH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ADD76875
UniProt: D4GDI8
Position
complement(1913111..1914157)
Genome map
AA seq 348 aa AA seqDB search
MNKTDELRTARIGSLISPASLAAEHPLSTTMADNITAARKRIARILTGEDPRLLVVIGPC
SLHDPVAALDYAQRLVALRERYQDRLEIVMRTYFEKPRTVVGWKGLISDPDLDGSFDVNR
GISIARKLLIDINALGLPTATEFLDMVIGQFIADLISWGAIGARTTESQIHREMASALSC
PVGFKNGTDGNVRIAVDAIRASRASHMFLSPDKQGQMTIYQTSGNPHGHVILRGGKQPNY
HAGDVAEAAACLAEFGLPQQLVIDFSHGNCLKQHRRQRDVALDVSGQIKSGSRAVAGVMI
ESFIEEGNQKVVSGEPLTYGQSITDPCLSWQDSEEVLALLAEAVSHRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactgatgaactgcgcaccgcgcgcattggcagcctgatttcccctgccagt
ctggcagctgaacacccgctttcgactaccatggccgataacatcaccgccgcacgcaag
cgcattgcccgcattctgaccggagaagatccccgtctgctggtggtgattggcccctgt
tcgctgcatgacccggtcgccgcgctggactacgctcagcgtttggtcgctctgcgtgag
cgttatcaggatcggctggaaatcgtgatgcgcacctatttcgaaaaaccacgcacggtt
gtgggctggaaaggcctgatttccgatcccgatctggacggcagctttgatgttaatcgc
ggcatcagcatcgcccgcaagctactgattgatatcaatgcgttgggtttaccgaccgcc
accgaattcctggatatggtgatcggccagtttattgccgatctgattagctggggggca
attggcgcccggaccaccgaaagccagatccatcgtgaaatggcctcggcgctctcctgc
ccggtcggttttaaaaacggaacagatggaaacgtccgcattgccgtggatgccattcgt
gcatcccgtgccagccatatgtttctgtcgcccgacaaacaaggtcagatgacgatttac
cagaccagcgggaatccgcacggccatgtgattctgcgtggcggcaaacagcctaattat
catgcaggcgacgttgccgaagccgctgcctgtttagctgagtttggtctgccgcagcag
ttggtgattgatttcagccacggcaactgcctcaagcagcatcgccgtcagcgcgatgtt
gcactggacgtctccgggcagattaaaagcggctctcgcgccgttgccggggtaatgatt
gaaagttttattgaggaaggcaatcaaaaagtggtgagcggtgaacccctgacttacggt
cagtcgatcaccgatccctgcctcagctggcaggacagcgaagaggtccttgcgctgtta
gctgaggcggtttctcaccgtctgtaa

KEGG   Pantoea ananatis LMG 20103: PANA_3017Help
Entry
PANA_3017         CDS       T01195                                 

Gene name
aroF
Definition
(GenBank) AroF
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
pam02024  Quorum sensing
Module
pam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_3017 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PANA_3017 (aroF)
Enzymes [BR:pam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     PANA_3017 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ADD78184
UniProt: D4GLD1
Position
complement(3389995..3391095)
Genome map
AA seq 366 aa AA seqDB search
MSVKDRTMQKDALNNVHIANEQVLITPEELKTKFPLSNAQQAQIAASRQTIADIIAGRDS
RLLVVCGPCSIHDTEAALDYARRLQSLSEQVKDRLYLVMRVYFEKPRTTVGWKGLINDPY
MDNSFDMEAGLHIARELLVNLVDMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTH
REMASGLSMPVGFKNGTDGSLGTAINAMRAAAMPHRFVGINQSGQVCLLQTQGNPDGHVI
LRGGKAPNYSPEDVAQCETAMLKAGLRPALMIDCSHGNSDKDYRRQPGVAQSAIDQIKKG
NRSIIGLMLESHISEGNQSSEQPRSEMKYGVSVTDACINWNVTEALLREMHDELNEVLSA
RLSHEV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaaggacaggacgatgcaaaaagacgcgttaaacaatgttcatatcgccaat
gagcaggtgttgattactcccgaagagcttaaaacgaaattcccgttgagcaatgcgcag
caggcgcaaatcgccgcctcgcgccagacgattgcggatatcattgcaggccgtgattcc
cgcctgttagtggtttgtggcccatgctcaattcacgatacagaagcggctctggattat
gcgcgtcgtctgcaaagcctctctgagcaggtgaaagatcgcctgtaccttgttatgcgc
gtctacttcgagaaaccccgcacgaccgttggctggaaggggttaattaacgatccttac
atggataactcatttgatatggaagcgggtttgcacattgcccgtgagttgctggtgaat
cttgtcgatatgggcttgccgttagcgacggaagcgctggatccaaacagcccgcaatat
ttgggcgatctgtttagctggtcggcgattggcgcacgcacgacggaatcacaaacccac
cgtgaaatggcttcaggcctgtcaatgccggtgggctttaaaaacggtaccgatggcagc
ctggggacggcgataaatgccatgcgcgcggcggcaatgcctcatcggtttgtgggtatc
aatcagtcaggccaggtttgcctgttgcaaacacagggaaatcctgacgggcacgttatt
ttacgcggcggcaaagcaccaaactacagtccggaagacgtggcacaatgtgaaacggcc
atgcttaaagcgggactccgcccggccttaatgatagattgcagccacggtaactctgat
aaagactaccgccgtcagcctggcgtcgcgcaatcggccatcgatcagatcaagaaaggc
aaccgttcgattattggcctgatgctggaaagccacattagtgaaggcaatcagtcttcc
gagcagccgcgcagtgagatgaagtacggcgtctctgttaccgatgcctgcatcaactgg
aacgtcaccgaggcgttactgcgcgaaatgcatgatgagctaaacgaggttctgtcggcg
cgtctttcacacgaggtgtag

DBGET integrated database retrieval system