KEGG   Pantoea ananatis LMG 20103: PANA_1201Help
Entry
PANA_1201         CDS       T01195                                 

Gene name
galM
Definition
(GenBank) GalM
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00052  Galactose metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
Module
pam_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1201 (galM)
   00052 Galactose metabolism
    PANA_1201 (galM)
Enzymes [BR:pam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PANA_1201 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADD76368
UniProt: D4GMN3
Position
complement(1364820..1365881)
Genome map
AA seq 353 aa AA seqDB search
MQSIRRSGPMLNDVNSHAPDGQPWRITVLRNANGMIATFMDWGATWLSARVPLQDGHVRE
ALLGCATPSDYLHQDAYLGATVGRYANRIAGAKLNKISRQLSANQGEHQLHGGPEGFDKR
RWQIVSQSETEVHYRLDSPDGDQGYPGNLIADLRYVLDDDNCLSIHYQAQCDQPCPVGLT
NHAYFNLDAHHGDARQHRLQLHADRYLPVDSEGIPNGPLKAVDGTSFDFRQAKRIEQDFL
ADDDQKAVKGYDHAFLLNSAGDSSQPAAELWSEDGKLQLSVTTSAPALQFYSGNYLAGTR
AREQESYTAFQGIALESEFLPDSPNHPEWPQDDCWLQPGDRWESVTRYRFTPR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaagcatcagaaggagcgggccaatgctaaacgatgtgaactcccatgcgccggac
ggtcagccgtggcgcatcaccgtattacgtaatgccaatggcatgattgccacctttatg
gactggggcgcaacctggctgtcggcgcgagtcccactgcaggacggtcacgtgcgtgaa
gccctgctgggctgtgcaaccccttccgactatctgcatcaggatgcctatctgggtgcc
acggtaggccgttatgcaaaccgtattgccggcgcaaaactgaataaaatcagccgccag
ttgagtgccaatcagggcgaacatcagttacacggcggcccagaagggtttgataaacgc
cgctggcaaattgtcagtcagtcagaaacggaagtgcattatcgtcttgattcgcccgat
ggcgatcagggctacccgggcaaccttattgctgatttgcgctatgtactggatgacgat
aactgcctgtccattcactatcaggcgcagtgcgaccagccctgcccggtcggtctcacc
aaccatgcttactttaatcttgatgcgcatcatggtgatgcgcgccagcatcggttacaa
ctgcacgccgatcgttacctgcccgtggatagcgaggggattcccaacggcccactgaag
gcagtggacggcaccagcttcgatttccgtcaggccaaacgcattgagcaggattttctt
gccgatgacgatcagaaggcagttaaaggctatgaccatgctttcctgctgaacagtgca
ggcgatagcagccagcctgccgctgaactctggtcagaggacggcaagctccagttgagc
gtgaccacgtcagcgcccgcgttacagttctacagcggtaactatctggccggcacgcgc
gcccgggagcaggaaagctatactgcttttcaggggatcgcgctggagagtgaattttta
ccggattcgcctaatcatcccgagtggccacaggatgattgctggctgcaaccgggagat
cgttgggaatccgtcacgcgctatcgctttacaccacgctga

DBGET integrated database retrieval system