KEGG   Pantoea ananatis LMG 20103: PANA_1211Help
Entry
PANA_1211         CDS       T01195                                 

Gene name
pgl
Definition
(GenBank) Pgl
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00030  Pentose phosphate pathway
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pam_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA_1211 (pgl)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     PANA_1211 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL
Motif
Other DBs
NCBI-ProteinID: ADD76378
UniProt: D4GMP3
Position
1374552..1375553
Genome map
AA seq 333 aa AA seqDB search
MKQVVYTASPESQQIHVWQLNEDGTLTLLQVTDVAGQVQPMVVSPKKDFLYVGVRPDFRV
LAFRIASDGTLTEAGQAPLPGSPTHISTDHAGRFLFCGSYNDACVSISPIGDDGVPQAPS
QVINGLAGCHSANIDNADRTLYVPALKQDRICLFTLGADGQLTPHSQEQVTTAEGAGPRH
MAFHANGQYAYSVNELNSTVEVWALNNAQGKVESVQTLDMMPPDFTGTRWAADIHLTPDG
RFLYACDRTSSTLTVFSVSEDGAVLTVEGFQPTETQPRGFNIDHAGQFLVAAGQKSHHIE
VYNITQPQGLLKPVGRYAVGQGPMWVVVHQLAG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggttgtctacaccgccagtcccgagagtcaacaaatccatgtctggcagttg
aatgaagatggcaccttgacgctcctgcaggttacggatgtcgccggtcaggttcagcct
atggtggtgagtccaaaaaaagatttcttgtatgtaggcgtgcgccccgacttccgtgta
ctggcgtttcgcatcgcctcagacggcaccttgaccgaagccggacaggcgcctctgccg
ggcagcccgacccatatttccaccgatcatgccggccgtttcctgttttgcggctcttac
aacgatgcgtgcgtcagtatcagcccaataggggatgacggcgtgccacaggcaccgagc
caggtcattaacggcctggcgggatgccactccgccaatatcgataatgccgatcggacg
ctgtacgtgcctgccctgaagcaggatcgcatttgcctgtttacccttggcgcagacggt
cagttaaccccgcattcgcaggagcaggttaccacggcggaaggcgccgggcctcgccac
atggcgtttcatgccaacggacagtacgcctacagcgtcaatgagctgaacagcacggtc
gaggtctgggcgctgaacaatgcgcagggcaaggtcgagtcggtacagacgctggatatg
atgccgcctgattttaccggtacccgctgggctgccgatattcatctgacgccagacgga
cgtttcctgtacgcctgcgatcgcaccagcagcaccttaacggtctttagcgtcagcgaa
gacggtgccgtgctgacagtcgaagggtttcagccgaccgaaacgcagccgcgcggattc
aatatcgatcacgcgggtcagttcctggtggcggcggggcagaagtcacaccacatcgaa
gtctacaatatcactcagccacagggcttactgaagccggtgggccgttacgccgttgga
cagggtcctatgtgggtagtggtacatcagctggcaggataa

DBGET integrated database retrieval system