KEGG   Pantoea ananatis LMG 20103: PANA_1407Help
Entry
PANA_1407         CDS       T01195                                 

Gene name
agp
Definition
(GenBank) Agp
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1407 (agp)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     PANA_1407 (agp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 HC2
Motif
Other DBs
NCBI-ProteinID: ADD76574
UniProt: D4GBX1
Position
1595457..1597112
Genome map
AA seq 551 aa AA seqDB search
MNGIGTMIKKLSLCALSVLAALPIGTLAQAADNDMQLQQVLMFSRHNLRAPLADNGSVLA
QSTKKTWPEWDVPGGQLTTKGGVLEVYMGNYTRQWLAQQGLVKNGVCPDSNSVFVYANSL
QRTVATAQFFVNGAFPGCDIAVTHQDEMGSMDPVFNPVITDGNEEFIKKALAGMTAANEK
LSLKPAFQRLEKIVDYKSSPACNNKKQCDLSNGQNTFIVENGKEPGVNGPLKVGNSLMDA
FTLQYYEGFPLDQVAWGQIKTPEQWQALSAIKNGYQDTLFTTPEVARDVAAPLVDYIRSQ
LIDQEKSDSPKVTLMVGHDSNIASLLSALQVKPYDLPETYEKTPIGGQVVFERWHDAKNN
KDLLKIEYVYQTADQLRDAEVLSLKKPPKRVTLQLAGCPTDANGYCSWDQFAQVLNSALQ
GTALQPAAEAQPAQPATAAKPEDAKAATAGDAAQKADADKAAADKAAAQKAADEKAKADK
AAEEKANADKAAAQKAADEKAKADKAAAQKAADEKAKADSSAAPAGSSNAPGSNAQTKAE
TGEAKQPATAN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaataggcacaatgatcaagaaactgagtctttgcgcattgtcggtacttgct
gcattaccgattggaacgctggcacaggccgctgacaacgatatgcagttacagcaggtg
ttaatgttcagccgccataacctgcgtgcaccgcttgcggataacggcagcgtgctggcg
caatccaccaaaaaaacctggccggagtgggatgtgccgggtggacagctgaccactaaa
ggcggcgtgctggaagtgtacatgggtaactatacccgtcagtggcttgctcagcagggg
ctggtaaaaaatggcgtttgtccggacagcaacagcgtctttgtctacgccaacagcctg
cagcgtaccgtggcgacggctcagttcttcgtaaatggtgccttcccgggctgtgacatt
gctgtgactcaccaggatgaaatgggcagcatggatccggtatttaatccggttattaca
gacgggaacgaagaattcattaagaaagcgctggccggaatgaccgctgccaacgaaaag
ctgtcactgaaacccgcttttcagcggctcgagaagattgttgactacaaatcctctcct
gcctgtaataacaaaaagcagtgcgatctgagcaatggccagaacacctttatcgttgaa
aacggcaaagaacccggcgtgaacgggccactaaaagtgggcaattcgctaatggatgcc
tttacgctgcaatattatgaaggcttcccgctggaccaggtcgcctggggacaaatcaaa
acccctgaacagtggcaggcactatccgctattaaaaatggctatcaggacacgctgttt
accacgcctgaggttgcacgcgacgttgccgcgccactggtggactacattcgcagccag
ctgatcgatcaggaaaagtcagactcacctaaagttacgctgatggtcgggcatgactcc
aacattgcgtcactgctaagtgcgttacaggttaagccttatgacttacctgagacctac
gaaaaaacgccaatcggcggtcaggtggtgtttgaacgctggcacgatgcgaaaaacaat
aaagatctgcttaaaatcgaatacgtttatcagaccgccgatcaactgcgcgatgcagag
gttctgagccttaagaagccgcctaagcgcgttacgcttcaactggcgggttgcccgaca
gacgctaacggatactgcagctgggatcagtttgcccaggtgctgaacagcgcactacag
ggtacggcgctgcaacctgctgcggaagcccagccggcacagcctgcgactgcggcgaaa
cctgaggatgcgaaagcggccacggcgggcgatgcggcgcaaaaggcggatgctgataag
gcggccgccgacaaagccgccgcgcagaaagcggctgatgagaaggccaaagcggataaa
gcggctgaagaaaaggctaatgctgacaaggcggctgcgcagaaagccgcagacgaaaag
gccaaagcagataaggctgccgcgcaaaaagcggctgatgagaaggctaaggccgacagc
agcgcggccccggctggcagcagcaatgcgcctggcagtaatgcgcagaccaaagctgaa
accggtgaggcgaagcaacccgctaccgccaactga

DBGET integrated database retrieval system