KEGG   Pantoea ananatis LMG 20103: PANA_1513Help
Entry
PANA_1513         CDS       T01195                                 

Gene name
purB
Definition
(GenBank) PurB
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam00250  Alanine, aspartate and glutamate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
pam_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_1513 (purB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA_1513 (purB)
Enzymes [BR:pam01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     PANA_1513 (purB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C
Motif
Other DBs
NCBI-ProteinID: ADD76680
UniProt: D4GC77
Position
complement(1701926..1703296)
Genome map
AA seq 456 aa AA seqDB search
MELSSLTAVSPVDGRYGDKVSPLRAIFSEFGLLKFRVEVEVRWLQKLAATAEIKEVPAFD
ADANAFLDGIVTSFNETDAARIKTIERTTNHDVKAVEYFLKEKVADVPSLHAVSEFIHFA
CTSEDINNLSHALMLETARRDVILPYWQQLIAAVKGLAQEYRDIPLLSRTHGQPATPSTM
GKEMANVAYRMERQLRQLSQIEVLGKINGAVGNYNAHIAAYPEADWHQLSEEFVTSLGIT
WNPYTTQIEPHDYIAELFDCIARFNTILIDFDRDIWGYVALNHFKQKTIAGEIGSSTMPH
KVNPIDFENSEGNLGLANAVMQHLASKLPVSRWQRDLTDSTVLRNLGVGVGYALIAYQAT
LKGISKLEVNRDRLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAAGMQ
AFIDSLALPEDEKVRLKQMTPANYIGRAIQMVDDLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggaattatcctctctgaccgccgtctcacctgtcgatggtcgttacggcgataaagtc
agcccgctgcgcgcaatcttcagcgaatttggtttgctgaagttccgcgttgaggttgaa
gttcgctggttacaaaaattggctgcgaccgcagagatcaaggaagttcctgcatttgat
gctgacgcaaacgctttccttgatgggattgtcaccagtttcaatgaaacggacgccgcg
cgcatcaaaacgattgagcgcaccactaaccatgacgtgaaagcggttgagtatttcctg
aaagaaaaagtggctgacgtgccttcgctgcacgcggtgtctgagtttattcacttcgcc
tgtacctctgaagacatcaataacctgtctcacgcgttaatgctggaaacggcgcgtcgc
gatgtcattctgccttactggcagcagctgattgccgcggtaaagggactggcgcaggaa
taccgtgacattcctctgctgtcacgcactcacggtcagcccgcaacgccgtccaccatg
ggtaaagagatggccaacgtggcctaccgcatggaacgtcagctacgccagctgtcgcag
attgaagtgctgggcaaaatcaacggtgccgtgggcaactataacgcgcacattgccgct
tacccggaagccgactggcaccagttaagcgaagaatttgtgacctcgctgggcattacc
tggaatccctacaccacccagattgagccacacgactatattgccgagctgttcgactgc
atcgcccgctttaataccatcctgatcgatttcgatcgcgatatctggggctatgtggcg
ctcaaccacttcaaacaaaaaaccatcgcgggcgaaatcggctcttccaccatgccgcat
aaagtaaacccgattgacttcgaaaactcagaaggcaatctgggcctggcaaacgcggtg
atgcagcacctggccagcaaactgccggtttcccgctggcagcgcgatctgaccgactct
accgtgctgcgtaaccttggcgtgggcgtgggttatgcgctgatcgcttatcaggctacc
ctgaaaggcatttccaagctggaagtgaaccgggatcgtctgcttgacgaactggatcat
aactgggaagtgctggcagagccgatccagaccgttatgcgtcgctacggtattgaaaaa
ccttatgagaagttgaaagaactgacccgtggcaagcgcgttgatgcggccggtatgcag
gcctttatcgacagcctggcgctgccggaagacgaaaaagttcgcttaaaacagatgacc
ccggcaaattatattggtcgcgcgattcagatggttgatgacctgaaataa

DBGET integrated database retrieval system