KEGG   Pantoea ananatis LMG 20103: PANA_1582Help
Entry
PANA_1582         CDS       T01195                                 

Definition
(GenBank) Hypothetical Protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PANA_1582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pam01002]
    PANA_1582
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     PANA_1582
Peptidases [BR:pam01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   PANA_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase_3 Flu_NS1
Motif
Other DBs
NCBI-ProteinID: ADD76749
UniProt: D4GCS6
Position
1779345..1780040
Genome map
AA seq 231 aa AA seqDB search
MRDSASKSIGLLLFPALTQLDLTAPYEVFVRAPNTKVHLIWKNLDLVVSDRGMAIQPTTT
FNTCPQLDVICIPGGPGQINLMDDEDVLSFIRFQSEEAKLVTSVCTGSLILGAAGLLDGY
KATTHWASLDQLALLGAEPVNERVVRDRNRITGAGVTSGIDFALTVVSEMHGSSIAENIQ
LHMEYDPAPPFTCGSPRTASEEQLKKAREQTAPFIEKRRQATLKAAARLQK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgattctgcaagcaaatcaatcgggctgctcctgttcccagcgcttactcagctt
gatcttaccgcgccatatgaagttttcgtcagggcacccaatacaaaggttcatctcatc
tggaaaaacctggaccttgttgtttccgatcgtggtatggctatacagccaacgaccact
tttaacacatgcccacaactggatgtaatttgtatccccggagggcctggtcagataaac
ctaatggatgatgaagacgttctttcatttatccgtttccaaagtgaagaagcaaagctg
gtgacttctgtatgcactggttcgctgattctgggcgcagcaggacttctggatggatat
aaagcaacgacgcactgggcttctctggaccaactcgctctgttaggtgcggagccagtt
aatgagcgcgtcgtccgtgaccgtaaccgtataaccggcgcaggtgtcacttcaggaata
gactttgcgctcaccgttgtatcagaaatgcacgggagcagtattgctgaaaatattcaa
ctgcatatggaatatgatcccgcaccgccgtttacctgtggctcgccccgaactgcatct
gaagagcagttaaaaaaggcgcgggaacaaacagcgccatttattgaaaagaggcgacag
gcgacgttaaaagccgcagccagactacagaaataa

DBGET integrated database retrieval system