KEGG   Pantoea ananatis LMG 20103: PANA_1607Help
Entry
PANA_1607         CDS       T01195                                 

Gene name
gyaR
Definition
(GenBank) GyaR
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00260  Glycine, serine and threonine metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PANA_1607 (gyaR)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_1607 (gyaR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pam04147]
    PANA_1607 (gyaR)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     PANA_1607 (gyaR)
    1.1.1.399  2-oxoglutarate reductase
     PANA_1607 (gyaR)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PANA_1607 (gyaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD RelE IlvN 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADD76774
UniProt: D4GCV1
Position
1804958..1805938
Genome map
AA seq 326 aa AA seqDB search
MTIQVCIPDDYHQATAGLDCLQCHPQFTCTAVGDISLDPDAEQALATAQALILIRERTTI
DEAFLHRTPQLKLISQTGKVARNIDIAACSRAGVAIVEGVGSPVAPAELTWLLIMAARRK
FVQAVNAMRAGHWQAELGKGVSNQTLGILGYGKIGKRIAAYAKAFGMRVQVWGSDRARQE
AQQEGVIVPASREVFFASSDVITVHQRLVAATEGNITRDDLVQMKPDALFVNTSRAELVA
ADALLSALRQGRPGFAALDVYEQEPVYDPAHPLLSLPNVLCTPHIGYVEKDSYSLYFGTA
FENVVRFFDGDRSHVINPESLREHEK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacaggtttgtattcccgacgattatcatcaggccacggcaggcctcgactgc
ctgcaatgccatccccaatttacctgtaccgctgttggggatatcagcctggatcctgat
gcagaacaggcgctggcgacggctcaggccttgatcctgatccgtgagcgcaccaccatt
gacgaggcctttttacatcgcacgccgcaactaaagctcatcagtcagaccggtaaggtc
gcccgcaatatcgatattgcggcctgctcacgggcgggtgtggcgattgtcgagggcgtc
ggctcgcccgttgcaccggctgaactgacgtggctgctgattatggcagcccgcagaaag
ttcgttcaggccgttaacgccatgcgcgccggtcactggcaggcagagctggggaagggc
gtgagtaaccagacgctggggatcctgggctacggtaaaattggcaagcggattgcggct
tatgcaaaggcatttggtatgcgggtgcaggtctggggcagcgatcgcgccaggcaggaa
gcgcagcaggagggagtgatagtgcctgccagccgtgaggttttttttgcctccagcgac
gtgataaccgttcatcagcgcttagtggcagcaaccgagggcaatatcacgcgcgacgat
ctggtgcagatgaagcccgatgcattgttcgtcaacaccagccgggctgagctggtggcc
gcagatgcgctgctgagtgcgctgcgccagggccgcccgggttttgccgctctggacgtt
tatgagcaggagccggtatacgatcccgcgcatccgctgttatcactgcccaacgtgctc
tgcacgccgcacatcggctatgtcgagaaggacagctacagcctgtatttcggcaccgcg
ttcgaaaacgtggtgcgctttttcgacggtgaccgaagccatgtaatcaatcctgaatct
cttagggagcatgaaaaatga

DBGET integrated database retrieval system