KEGG   Pantoea ananatis LMG 20103: PANA_1833Help
Entry
PANA_1833         CDS       T01195                                 

Gene name
fumC
Definition
(GenBank) FumC
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00020  Citrate cycle (TCA cycle)
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PANA_1833 (fumC)
   00620 Pyruvate metabolism
    PANA_1833 (fumC)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     PANA_1833 (fumC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C G-alpha
Motif
Other DBs
NCBI-ProteinID: ADD77000
UniProt: D4GE93
Position
2045826..2047223
Genome map
AA seq 465 aa AA seqDB search
MAANRVEKDSMGPIDVPAEKLWGAQTQRSLEHFRISTEKMPVALVHALAMTKRAAASVNR
DLGLLPAERAEAIVNAADEVLADKHSDEFPLAIWQTGSGTQTNMNMNEVLANRASELLGG
ERGMSRLVHPNDDVNKSQSSNDVFPTAMHVAAVIAVREHLIPQLNVLKQTLSAKSEAFKD
IVKIGRTHLQDATPLTLGQEISGWVAMLEHNLRHIEQSIPHLGELALGGTAVGTGLNTHP
EYAVRVAKALADLTGQPFVTAPNKFEALATCDALVHAHGALKGLAASLMKIANDVRWLSS
GPRCGIGEIAIPENEPGSSIMPGKVNPTQCEALTMLCCQVMGNDVAINMGGASGNFELNV
YRPMIIHNFLQSVRLLADGMDSFNHHCATGIEPVRERIEQLLNESLMLVTALNTHIGYDK
AAEIAKQAHKQGLTLKASALKLGYLTEDEFDAWVRPEEMVGSMKQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaatcgcgttgaaaaagattcaatggggccaattgatgtaccggctgagaaa
ctttggggcgctcagacacagcgctcactggagcacttccgcatctcgacagaaaaaatg
cctgtcgcgctggttcatgcgctggcaatgaccaagcgcgccgccgcgagcgttaaccgg
gatctgggcttattaccggccgagcgggcggaagcgatcgtgaacgccgccgatgaggtg
ttagcggacaagcacagtgacgaattccccctggcaatctggcagaccggttcaggtacc
cagaccaacatgaacatgaatgaagtgttggctaaccgggccagtgagctgctcggcgga
gagcgcggtatgtcgcgcctcgtgcatcctaacgacgatgtcaacaagagccagagttcg
aatgatgtgtttcccaccgccatgcacgtggcggccgtcattgcggtgcgtgaacatctg
atcccacagctgaacgtgcttaaacaaacgctgagcgccaaatctgaggcgtttaaagac
atcgttaaaattggccgcacccatctccaggacgccacgccgttaacactgggacaggaa
atctcgggctgggttgccatgcttgagcataacctcaggcacatcgaacagagcattccg
caccttggagaactggcgctgggtggaacggcggtaggaaccgggttgaatacgcatcct
gaatatgccgttcgcgtggctaaagcactggccgacctgaccggacaaccctttgtgacc
gcgcccaacaaatttgaagcgctggcaacctgcgatgcgctggtgcatgcgcacggcgca
cttaaagggctggcggcgtcgttgatgaagattgccaacgacgtgcgctggctgtcatcg
ggcccacgttgtggtatcggtgaaatcgctattccggaaaatgaaccgggcagctccatt
atgccgggcaaagtgaatccaacccagtgtgaagccctgacaatgttgtgctgccaggtg
atgggaaatgatgtagcgattaacatgggcggtgcgtcaggcaacttcgagctgaacgtt
tatcgtccgatgattattcataacttcctgcaatcggttcgtttactggccgacggcatg
gacagctttaaccaccattgcgcgaccggtattgagccggtgcgtgagcgaattgaacag
ttactcaacgaatcgctcatgctggttaccgcgttaaatacccacatcggttatgacaaa
gcggcggaaattgccaagcaggctcacaagcaaggcttaacgcttaaagcctcggcgctg
aaactgggttatctgactgaagacgagtttgatgcctgggttcgcccggaagagatggtt
ggcagcatgaagcagtga

KEGG   Pantoea ananatis LMG 20103: PANA_4119Help
Entry
PANA_4119         CDS       T01195                                 

Gene name
fumA
Definition
(GenBank) FumA
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00020  Citrate cycle (TCA cycle)
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PANA_4119 (fumA)
   00620 Pyruvate metabolism
    PANA_4119 (fumA)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     PANA_4119 (fumA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumerase_C Fumerase Myosin_head
Motif
Other DBs
NCBI-ProteinID: ADD79286
UniProt: D4GFG6
Position
4571842..4573548
Genome map
AA seq 568 aa AA seqDB search
MMLLLSACVNGASTSLSEILCRTNLFFYQNPFPLAHEDTEYYLLSPDHVSVAEFDGQSIL
KVDPQALTLLAQQAFHDASFMLRPAHQQQVASILADPEASDNDKYVALQFLRNSEIAAKG
VLPTCQDTGTAIIMGKKGQRVWTGGGDEAALSQGIYNTYIEDNLRYSQNAALDMYKEVNT
GTNLPAQIDLYSVDGDEYKFLCIAKGGGSANKTYLYQETKALLSPGKLKNYLVDKMRTLG
TAACPPYHIAFVIGGTSAESTLKTVKLASTHYYDGLPTEGNEHGQAFRDVQLEQELLEAA
QQLGLGAQFGGKYFAHDIRVVRLPRHGASCPVGMGVSCSADRNIKAKINREGIWIEKLEA
NPGRYIPEALRKQGEGEVVHIDLNRPMNDILAQLSEYPVSTRLSLTGTIIVARDIAHAKL
KERIDNGEGLPQYIKDHPVYYAGPAKTPEGYASGSLGPTTAGRMDSYVDLLQANGGSKVM
LAKGNRSQQVTDACHKHGGFYLGSIGGPAAVLAQQSIKSLECVEYAELGMEAIWKIEVEN
FPAFILVDDKGNDFFQHIEREHCSRCVK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
ttgatgttgctcctgtcagcctgcgttaacggagccagcacgtcattaagtgagatacta
tgtcgaacaaacctttttttttatcagaacccctttcctcttgcccacgaggacaccgaa
tactatttgcttagccccgaccacgtttccgtggctgagtttgacggccagtccatatta
aaagtggacccacaggcattgacgctgctggcccagcaggcctttcatgatgcgtctttt
atgttgcgcccggcccaccagcagcaggttgcgtcaattctggctgaccctgaagccagc
gataacgataaatacgtcgcactgcagttcttacgaaactccgagatcgccgctaaaggt
gtcttgccaacctgccaggacaccggcaccgccattatcatgggcaaaaaaggccagcga
gtgtggaccggtggcggtgacgaagccgcgctgtcgcaaggtatctacaatacctatatt
gaagataatctgcgttactcccaaaacgccgcgctggatatgtataaagaagtgaacacc
ggcaccaatcttccggcgcagattgacctctacagcgtggacggtgatgaatacaaattc
ctttgcatcgccaaaggcggcggttccgccaataaaacctatttgtatcaggaaaccaaa
gcactgctcagccccggcaagctgaaaaattatctggtcgataaaatgcgtacgctgggt
actgcggcttgtcctccctaccatatcgcctttgtcattggcggcacctctgccgaaagt
acgctgaaaaccgtcaagctggcatcgactcactactatgatggtttacctacagaaggt
aacgagcatggccaggcgttccgtgatgttcagcttgagcaggagttactggaagcggcg
cagcagcttgggctgggagcacagttcggcggcaaatattttgcacatgatatccgcgta
gtgcgtttgcctcgccacggcgcatcctgcccggttggcatgggggtttcgtgctccgct
gaccgcaatatcaaagctaaaatcaaccgcgagggtatctggattgaaaaactggaagcc
aatcctgggcgttatatccctgaggcactgcgcaagcaaggtgaaggcgaagtggttcac
atcgacctgaatcgcccgatgaatgacatccttgcccagctttcggaatacccggtttcg
acacgtttgtccctgaccgggaccatcatcgttgcgcgtgacattgcccatgccaaacta
aaagaacgcattgataacggcgaaggcttgccgcagtacattaaagatcaccctgtctat
tatgcgggtccggccaaaacaccggagggttacgcatctggctctctgggcccgacgacg
gcaggccgcatggattcgtatgtcgatcttctgcaggcgaatggcggcagcaaagtcatg
ctggcaaaaggtaaccgtagccagcaggtcaccgatgcctgccacaagcacggcggtttt
tacttaggcagcattggtggtccggctgccgttctggcgcagcagagcatcaagagtctg
gagtgcgtggagtatgccgaactggggatggaagctatctggaaaatagaggtcgaaaat
ttcccggcctttatcctggtggatgacaaaggaaatgacttcttccagcatatcgaacgt
gagcactgctcgcgctgtgtgaaataa

DBGET integrated database retrieval system