KEGG   Pantoea ananatis LMG 20103: PANA_1860Help
Entry
PANA_1860         CDS       T01195                                 

Gene name
pfkA
Definition
(GenBank) PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00030  Pentose phosphate pathway
pam00051  Fructose and mannose metabolism
pam00052  Galactose metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01230  Biosynthesis of amino acids
pam03018  RNA degradation
Module
pam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1860 (pfkA)
   00030 Pentose phosphate pathway
    PANA_1860 (pfkA)
   00051 Fructose and mannose metabolism
    PANA_1860 (pfkA)
   00052 Galactose metabolism
    PANA_1860 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PANA_1860 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PANA_1860 (pfkA)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PANA_1860 (pfkA)
Protein phosphatases and associated proteins [BR:pam01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PANA_1860 (pfkA)
Messenger RNA biogenesis [BR:pam03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PANA_1860 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ADD77027
UniProt: D4GEC0
Position
2081772..2082680
Genome map
AA seq 302 aa AA seqDB search
MTQAEMILFNGGIPGLLDNVCQEISQRDLVDFSITSLPVMQSGRTARKLIRSEYETIARQ
LKALRIDVLILAGGDGSLQFLHTLSEFGVNCFGIGMTIDNDVYGSDYTVGFSTACEQVLK
EVAKLRNTGRALTGRVFMVELLGGYCGELTLQSALKSNADFALIPECQIPTNVLAERITQ
RLSEQNSVVILCSEGYTREYSPGFQGAIDTLIKQLEPLIGVRIRKTIVGYGLRNGDPTCE
EIYQGTIMASEVVRCIQSGMRNKAVIINGSNKPIPIDLISMKKRLVDTEGHHYKLAKQLH
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcggagatgatattatttaacggtggcattccaggcttgctggataatgtc
tgccaggaaatttctcagcgcgatttagtggatttttccattacttctcttccggtaatg
cagtcaggccgaaccgcgcgaaaattaattcgtagcgaatatgaaacgatcgcccggcag
ttaaaagcattacgcatcgacgtattaattctggctggaggcgatggatcgctgcaattt
ctgcatacgctcagtgaatttggtgtgaactgttttggcatcggcatgacgattgacaac
gatgtctacggcagtgattacaccgtgggcttttccaccgcctgtgagcaggtattaaaa
gaggtggcaaagctcagaaacaccggtcgggcattaacgggccgggtatttatggtggaa
ctgctcggcggctactgtggcgaattgacgctccagtcagcgctcaaatccaacgccgac
tttgcgctgatcccggaatgccagatccccacaaacgtgctggcagaacgcatcactcag
cgcctcagcgaacaaaacagcgtggtaatcctctgctcagaaggttacacacgggaatat
tcaccgggctttcagggggcgattgacacattaattaagcagcttgaaccgttgatcggc
gtgcgcattcgcaaaacgatcgtcggctatggactgcgaaatggcgatcccacctgtgag
gaaatttatcagggcaccattatggcaagtgaagtggttcgttgtattcaatccggaatg
cgcaataaagccgtgattattaacggcagtaataagcctattccgattgacttaataagc
atgaaaaaacgcctggtcgatacagaagggcatcattataaactcgctaaacaactgcat
atattgtga

DBGET integrated database retrieval system