KEGG   Pantoea ananatis LMG 20103: PANA_1860Help
Entry
PANA_1860         CDS       T01195                                 

Gene name
pfkA
Definition
(GenBank) PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00030  Pentose phosphate pathway
pam00051  Fructose and mannose metabolism
pam00052  Galactose metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01230  Biosynthesis of amino acids
pam03018  RNA degradation
Module
pam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1860 (pfkA)
   00030 Pentose phosphate pathway
    PANA_1860 (pfkA)
   00051 Fructose and mannose metabolism
    PANA_1860 (pfkA)
   00052 Galactose metabolism
    PANA_1860 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    PANA_1860 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PANA_1860 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pam01009]
    PANA_1860 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pam03019]
    PANA_1860 (pfkA)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PANA_1860 (pfkA)
Protein phosphatases and associated proteins [BR:pam01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PANA_1860 (pfkA)
Messenger RNA biogenesis [BR:pam03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PANA_1860 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ADD77027
UniProt: D4GEC0
Position
2081772..2082680
Genome map
AA seq 302 aa AA seqDB search
MTQAEMILFNGGIPGLLDNVCQEISQRDLVDFSITSLPVMQSGRTARKLIRSEYETIARQ
LKALRIDVLILAGGDGSLQFLHTLSEFGVNCFGIGMTIDNDVYGSDYTVGFSTACEQVLK
EVAKLRNTGRALTGRVFMVELLGGYCGELTLQSALKSNADFALIPECQIPTNVLAERITQ
RLSEQNSVVILCSEGYTREYSPGFQGAIDTLIKQLEPLIGVRIRKTIVGYGLRNGDPTCE
EIYQGTIMASEVVRCIQSGMRNKAVIINGSNKPIPIDLISMKKRLVDTEGHHYKLAKQLH
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcggagatgatattatttaacggtggcattccaggcttgctggataatgtc
tgccaggaaatttctcagcgcgatttagtggatttttccattacttctcttccggtaatg
cagtcaggccgaaccgcgcgaaaattaattcgtagcgaatatgaaacgatcgcccggcag
ttaaaagcattacgcatcgacgtattaattctggctggaggcgatggatcgctgcaattt
ctgcatacgctcagtgaatttggtgtgaactgttttggcatcggcatgacgattgacaac
gatgtctacggcagtgattacaccgtgggcttttccaccgcctgtgagcaggtattaaaa
gaggtggcaaagctcagaaacaccggtcgggcattaacgggccgggtatttatggtggaa
ctgctcggcggctactgtggcgaattgacgctccagtcagcgctcaaatccaacgccgac
tttgcgctgatcccggaatgccagatccccacaaacgtgctggcagaacgcatcactcag
cgcctcagcgaacaaaacagcgtggtaatcctctgctcagaaggttacacacgggaatat
tcaccgggctttcagggggcgattgacacattaattaagcagcttgaaccgttgatcggc
gtgcgcattcgcaaaacgatcgtcggctatggactgcgaaatggcgatcccacctgtgag
gaaatttatcagggcaccattatggcaagtgaagtggttcgttgtattcaatccggaatg
cgcaataaagccgtgattattaacggcagtaataagcctattccgattgacttaataagc
atgaaaaaacgcctggtcgatacagaagggcatcattataaactcgctaaacaactgcat
atattgtga

KEGG   Pantoea ananatis LMG 20103: PANA_3504Help
Entry
PANA_3504         CDS       T01195                                 

Gene name
fbp
Definition
(GenBank) Fbp
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00030  Pentose phosphate pathway
pam00051  Fructose and mannose metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_3504 (fbp)
   00030 Pentose phosphate pathway
    PANA_3504 (fbp)
   00051 Fructose and mannose metabolism
    PANA_3504 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    PANA_3504 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pam04147]
    PANA_3504 (fbp)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PANA_3504 (fbp)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PANA_3504 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: ADD78671
UniProt: D4GNW6
Position
3897466..3898473
Genome map
AA seq 335 aa AA seqDB search
MKTLGEFIVEKQHDFPHATGELTALISAIKLGAKIIHRDINKAGLVDILGASGVENVQGE
QQMKLDLFANEKLKAALKARGIVAGIASEEEDEFVIFEGEENGKYVVLMDPLDGSSNIDV
NVSVGTIFSIYRRVSEPGTPVVEADFMQPGNKQVAAGYVVYGSSTMMVYTTGCGVHAFTY
DPSLGVFCLSHERMTYPEVGYTYSINEGNYIRFPQGVKKYLKFCQEEDVATHRPYTSRYI
GSLVADFHRNLLKGGIYLYPSTASHPKGKLRLLYECNPMAFLAEQAGGKASDGQNRILDI
PPVTLHQRCPFYCGNTAMVDDVERFLAEFPECRQG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttgggcgaatttatcgtcgagaagcaacacgactttccgcacgccacaggt
gaactgacggcacttatctcagccattaagctgggtgctaaaattattcaccgtgatatc
aacaaagccggcttagtcgatattcttggtgccagcggcgttgagaatgttcagggtgaa
cagcagatgaaactggatctgttcgccaacgaaaaactcaaagccgcactgaaagcacgc
ggcattgttgccggtatcgcttctgaagaagaagatgagtttgttatctttgaaggcgag
gaaaacggaaaatacgtcgtattgatggacccgctcgacggttcgtcgaacatcgatgtt
aacgtctccgtcggcaccattttctccatctatcgccgcgtcagcgagccgggtacgcca
gttgtcgaagccgacttcatgcagccaggcaacaaacaggttgccgccggttacgtcgtt
tatggctcatccaccatgatggtgtacaccaccggttgtggcgtccatgcgtttacctac
gatccgtccctgggcgtgttctgcctcagccatgaacgcatgacctatccggaagtgggt
tacacctattccattaacgaaggtaactacattcgtttcccacagggcgtgaaaaagtac
ctgaaattctgtcaggaagaggatgtggcgacgcaccgtccttacacatcacgctatatc
ggctctctggtcgcggattttcaccgtaacctgctgaagggcggcatttatctttatccc
agcaccgccagccatccaaaaggcaagctgcgcctgctgtatgagtgcaaccctatggct
ttcctggcggagcaggccggcggtaaagccagcgacggtcagaaccgtatcctggatatt
cccccggtcacgctgcaccaacgctgtccgttctactgcggtaacaccgccatggttgac
gacgtagagcgtttcctggctgaattccccgagtgccgtcagggctaa

KEGG   Pantoea ananatis LMG 20103: PANA_3861Help
Entry
PANA_3861         CDS       T01195                                 

Gene name
glpX
Definition
(GenBank) GlpX
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00030  Pentose phosphate pathway
pam00051  Fructose and mannose metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_3861 (glpX)
   00030 Pentose phosphate pathway
    PANA_3861 (glpX)
   00051 Fructose and mannose metabolism
    PANA_3861 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    PANA_3861 (glpX)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PANA_3861 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX YejG
Motif
Other DBs
NCBI-ProteinID: ADD79028
UniProt: D4GDY6
Position
4283723..4284934
Genome map
AA seq 403 aa AA seqDB search
MSANSVQHLKPQSVTSVMPAGRKLSRARKRGKNKSNPHCARDLLRHGPFPRLLPPLHCQP
VFCQVHAMKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVHAMRHVLNTIQIDGQI
VIGEGEIDEAPMLYIGEKVGTGQGDAVDIAVDPIEGTRMTAMGQANALAVMAVGDKGSFL
HAPDMYMEKLIVGPAARGHINLDLPLEINLRNIAIAMNKPLSQLTVSILSKPRHDAVIEQ
LKQLGVRLFAFPDGDVAASILTCMPDSEVDVMYGIGGAPEGVVSAAVIRALDGDMQGRLL
ARHHVKGDSEENRRIGEYELKRCAGMGIEAGKVLPLQAMARNDNVIFAATGITSGDLLKG
ITRQGNMATSETLLIRGKSRTIRRIQSVHYLDRKDPVLHPFIL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcgaattccgtccaacacttgaaaccacagagcgtaacgtccgttatgccggct
ggaagaaagctgtcgcgcgcgcgcaagcgtgggaagaacaagagtaatccgcactgcgcc
cgtgacctcctccgtcacgggccttttccccgccttctccctccgctacactgccagcct
gttttttgtcaggtacatgcaatgaaacgagaacttgccattgaattttcccgcgtaact
gaggctgccgcactggctggttataagtggttagggcgcggcgataaaaacgcggcggac
ggtgccgccgttcatgccatgcgtcatgtcttaaataccattcagatcgatggacagata
gtgatcggcgaaggggaaattgacgaagcccctatgctctacatcggcgaaaaagtgggc
acgggtcagggcgacgcggtggatattgccgtcgatcctattgaaggtacccgcatgacg
gccatgggacaggccaatgcgcttgccgtgatggccgtcggtgacaaaggcagttttctt
catgcgcctgacatgtatatggagaagcttatcgtcggtccggcggcgcggggccatatc
aatctggatctcccgcttgagattaacctgcgtaatatcgccatcgccatgaataagccg
ttgtcacaactcaccgtgtccattctgtcaaagccgcgccatgacgccgttatcgagcag
cttaaacagctgggcgtaagactattcgcgttccctgatggtgatgtggcggcctccatt
ctgacctgtatgcccgacagcgaagttgacgtgatgtacggtattggcggcgcgcctgaa
ggcgtggtatcggccgctgtgattcgtgcgttggatggtgatatgcagggcagattactg
gcacgacatcacgtaaaaggtgacagcgaagagaaccgcaggattggggaatatgagctg
aaacgctgcgctggcatggggattgaggcaggaaaagtcctgcccctgcaggcgatggcg
cgaaacgataacgtgatctttgccgccaccggtatcaccagtggtgatctgctgaaaggc
atcacccgtcagggcaatatggccaccagtgaaaccctgttaattcgcggcaaatcacgc
acgattcgccgcatccagtctgtgcattacctggaccgcaaagatccggttttgcatccc
tttatcctgtaa

KEGG   Pantoea ananatis LMG 20103: PANA_3869Help
Entry
PANA_3869         CDS       T01195                                 

Gene name
pfkA
Definition
(GenBank) PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00030  Pentose phosphate pathway
pam00051  Fructose and mannose metabolism
pam00052  Galactose metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01230  Biosynthesis of amino acids
pam03018  RNA degradation
Module
pam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_3869 (pfkA)
   00030 Pentose phosphate pathway
    PANA_3869 (pfkA)
   00051 Fructose and mannose metabolism
    PANA_3869 (pfkA)
   00052 Galactose metabolism
    PANA_3869 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    PANA_3869 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PANA_3869 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pam01009]
    PANA_3869 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pam03019]
    PANA_3869 (pfkA)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PANA_3869 (pfkA)
Protein phosphatases and associated proteins [BR:pam01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PANA_3869 (pfkA)
Messenger RNA biogenesis [BR:pam03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PANA_3869 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADD79036
UniProt: D4GDZ4
Position
complement(4291186..4292169)
Genome map
AA seq 327 aa AA seqDB search
MNNPEVVMIKKIGVLTSGGDAPGMNAAIRGVVRSALSEGLEVFGIYDGYQGLYEDRMINL
DRYSVSDMINRGGTFLGSARFPEFRNDDVRQVAIENLKKRGIDALVVIGGDGSYMGAKRL
TEMGFPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRY
CGDLTLAAAIAGGCEFIVLPEIPYTREELVAEIKAGIAKGKKHAIVAITEHICDIDDLAR
FIETETKRETRATVLGHIQRGGAPCAYDRILASRMGAYSIELLMQGYGGRCVGIQNDKMV
HHDIIDAIENMKRPFKRDWMDTAKQLY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaatccagaggttgtcatgatcaaaaaaattggtgtactgaccagcggcggtgac
gccccaggcatgaacgcagccattcgcggcgtggttcgctccgcgttaagtgaagggctg
gaagtttttggtatctatgacggctatcagggtttgtacgaagaccggatgatcaatctc
gatcgttacagcgtatctgacatgattaatcgcggcggcacttttttgggttcagcgcgt
tttcctgagtttcgtaacgatgatgtccgtcaggtggccattgaaaacctgaaaaagcgc
ggtattgatgcgttagtcgtgattggcggggacggttcctatatgggcgccaagcgactg
accgagatggggttcccctgtatcggcctgccaggcacgatcgataacgatgttgccggc
accgattacaccattggctactttaccgcactggaaacggtggtggaggcgattgaccgc
ctgcgtgatacctcttcatcacaccagcgcatctccatcgttgaagtgatgggccgttac
tgtggcgatttgaccctggctgccgctatcgctggtggatgcgagtttatcgtgttgcca
gaaattccctatacccgtgaagagctggtggcagaaattaaggccggcatcgcgaaaggt
aaaaagcatgcgattgttgctatcactgaacatatctgtgatatcgacgatctggcgcgg
tttatcgagaccgaaacgaagcgcgaaacgcgcgcgacggtacttggccacattcagcgt
ggcggtgcgccgtgcgcatatgatcgtattcttgcatcccgcatgggcgcgtattccatt
gaactgctcatgcagggctacggtggccgctgtgtgggtattcagaacgacaaaatggtg
caccatgacatcattgatgcgatcgagaacatgaagcgtccattcaagcgtgactggatg
gataccgcgaagcagctttactga

DBGET integrated database retrieval system