KEGG   Pantoea ananatis LMG 20103: PANA_2070Help
Entry
PANA_2070         CDS       T01195                                 

Gene name
trpA
Definition
(GenBank) TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00260  Glycine, serine and threonine metabolism
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_2070 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_2070 (trpA)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PANA_2070 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ADD77237
UniProt: D4GFB5
Position
2318052..2318855
Genome map
AA seq 267 aa AA seqDB search
MERYDRLFSRLAEKKEGALVPFVTLGDPSPEMSLRIIDALVEGGADALELGIPFSDPLAD
GPTIQSATLRAFAAGTTTAQCFEMLAAIRHKYPELPVGLLMYANLVFSNGIDEFYARCAQ
AGVDSVLVADVPVEESAPFRQAAMRHGIAPIFICPPNASDELLREIASHGRGYTYLLSRA
GVTGTEKRASLPLDHLITKLREYHAAPPLQGFGISEPSQVRESLGAGSAGAISGSAVVKI
IEQHQAEPEVMLDALRTFIGNLKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgatcgactgttttcacgtctggcagagaagaaagaaggtgcactggtg
cctttcgttacgctgggcgatccgtcacccgaaatgtcattacgaattattgatgcgctg
gtagaaggtggtgcagatgcgcttgaactgggtattcccttttcagatccgctagcggat
ggtccgacaattcaaagcgcaacgctgcgcgcctttgctgcgggcaccaccacagcacag
tgctttgaaatgcttgctgccatccgtcataagtaccctgaattacctgttggcttactc
atgtacgccaaccttgtgttcagcaacggcattgatgaattttatgcccgctgtgcccag
gccggggttgattcggttctcgtggcagatgtgcccgtggaagaatccgcgccgttccgt
caggccgctatgcgtcacgggattgcgcccattttcatttgcccccccaacgccagcgat
gaactactccgtgaaattgcctctcacggccgcggttatacctatctgttgtcacgcgct
ggggtgaccggtaccgagaagcgggccagcctgccgctggaccacctgattacaaaatta
cgggaatatcatgcagcgccgccgctgcagggctttggcatttctgaaccctcgcaggtt
agagaatctctcggtgcgggctccgccggtgcgatctcaggttcggccgtggttaaaatc
attgaacaacatcaggcagaacccgaagtgatgctggatgccctgagaacctttattggt
aacctcaaagccgccacccgctaa

DBGET integrated database retrieval system