KEGG   Pantoea ananatis LMG 20103: PANA_2189Help
Entry
PANA_2189         CDS       T01195                                 

Gene name
purT
Definition
(GenBank) PurT
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam00670  One carbon pool by folate
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_2189 (purT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PANA_2189 (purT)
Enzymes [BR:pam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     PANA_2189 (purT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp CPSase_L_D2 Dala_Dala_lig_C ATP-grasp_3 2-Hacid_dh_C Epimerase LAL_C2 ATP-grasp_4 RmlD_sub_bind RimK
Motif
Other DBs
NCBI-ProteinID: ADD77356
UniProt: D4GGA5
Position
2440929..2442134
Genome map
AA seq 401 aa AA seqDB search
MTASILGEFMTTLGTALRPGATRVMLLGSGELGKEVALECQRLGVEVIAVDRYADAPAMH
VAHRSHVINMLDGDALAAVIAQEKPHFVVPEIEAIATEKLLELEQQGQHVVPTARAARLT
MNREGIRRLAAEELALPTSHYRFADSKDNFVSAAAEIGFPCIVKPVMSSSGKGQSFIRDA
SQLEKAWDYAQQGGRAGAGRVIVEGVVKFDFEITLLTISAVDGIHFCAPIGHRQEDGDYR
ESWQPQQMSELALQRAQHIAETVVKALGGYGLFGVELFVCGDEVVFSEVSPRPHDTGMVT
LISQDLSEFALHVRAFLGLPIGAVRQYGPSASAVILPQLTSQNVQFVNVEAALGSGLQLR
LFGKPEIDGQRRLGVALASADTTEEAVARAVASAAAVSVQG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgactgcttcgattttaggggaatttatgacgactcttggaactgcgctgcgccctggt
gcaacgcgcgtaatgctgttgggctccggtgaactggggaaagaagttgcgctggaatgt
cagcgcctgggtgtggaagtgattgccgttgaccgctacgctgatgcacctgccatgcat
gttgctcatcgcagccacgtgattaatatgctggatggtgacgcgctggccgcggtgatt
gcgcaggaaaagcctcacttcgtcgtacccgaaattgaagctattgcgactgaaaaactc
ctggagctggagcagcaaggccagcacgtcgtgccgacggcccgcgcggcgcgcctgacc
atgaaccgcgagggcattcgccgtctggcagcagaagagctcgcgcttcccacttcccac
taccgttttgccgacagcaaagataatttcgtgtctgccgccgccgaaattggttttccg
tgcatcgtgaagccagtgatgagctcttcaggtaaaggtcagagctttatccgggatgcc
agccagctggaaaaagcctgggactatgcgcagcaaggcggccgtgcgggtgccgggcgc
gttatcgtggaaggcgtggtgaagtttgattttgaaatcaccctgttaacgatcagtgcc
gttgacggcattcatttctgtgcccccattggtcatcgccaggaagacggggattaccgt
gaatcatggcaacctcagcagatgagtgagctggcgctgcagcgtgcgcagcacattgcg
gaaaccgtggtgaaagcgctgggtggctatgggctgtttggcgtagagctgtttgtctgc
ggcgacgaagtggtgttcagcgaagtctcccctcgcccgcacgataccggtatggtgacg
ctgatttcacaagatctgtctgaattcgcgcttcatgtgcgtgcgttccttggcctgccg
attggcgccgttcgccagtatggtccttccgcgtcagctgttatcctgccgcagttgacc
agtcagaacgtgcagttcgtcaatgtggaggcggcattgggttcaggtttgcagctgcgc
ctgtttggcaaacctgaaatcgacggtcagcgccgtttaggtgttgccctggccagtgcg
gatacaactgaagaagccgttgcgcgtgccgttgccagcgcggcggctgtcagcgttcag
ggatag

KEGG   Pantoea ananatis LMG 20103: PANA_2828Help
Entry
PANA_2828         CDS       T01195                                 

Gene name
purN
Definition
(GenBank) PurN
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam00670  One carbon pool by folate
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_2828 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PANA_2828 (purN)
Enzymes [BR:pam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     PANA_2828 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: ADD77995
UniProt: D4GK27
Position
3176262..3176900
Genome map
AA seq 212 aa AA seqDB search
MKKLVVLISGNGSNLQSILDACANGRIHGSVAAVFSNKASAYGLVRAERAGIPAIALDAR
DFSDRESFDRQLMREIDACAPDVVVLAGYMRILSPGFVAHYHDRLLNIHPSLLPKYPGLH
THRQALENGDAEHGTSVHFVTDELDGGPVILQAKVPVFAEDSEADITERVQHQEHAIYPL
VINWFVEGRLAMREGKAWLDGKPLPLQGYAHE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctggttgtgctgatctccggcaacggaagtaatcttcagtccatccttgac
gcctgtgcaaacgggcgtattcacggcagcgtcgctgccgtgttcagtaataaagcctcc
gcctatggcttagtccgcgcagagcgggcaggcattccggctattgccctggacgcccgt
gactttagcgaccgtgaaagttttgatcgccagcttatgcgtgagatcgacgcctgtgcg
ccggatgttgtggtgctggcaggatatatgcgcattttaagcccgggttttgtggcgcat
tatcacgaccgactgctgaatattcacccgtcgctcctgcccaaatatcccggactgcat
actcaccgccaggccctggaaaatggcgatgcggagcatggcacgtcagtgcatttcgta
acggatgaactggacggtggtccggtgattctgcaggccaaggtgcccgtttttgccgaa
gacagcgaagcggacattaccgagcgcgtgcagcatcaggaacatgccatctatccgctg
gtgattaactggtttgttgaaggccgcctggccatgcgtgagggaaaggcctggctggat
ggtaagccgttaccgcttcagggctacgcccacgagtaa

DBGET integrated database retrieval system