KEGG   Pantoea ananatis LMG 20103: PANA_2331Help
Entry
PANA_2331         CDS       T01195                                 

Gene name
hemH
Definition
(GenBank) HemH
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00860  Porphyrin and chlorophyll metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Module
pam_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PANA_2331 (hemH)
Enzymes [BR:pam01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     PANA_2331 (hemH)
    4.99.1.9  coproporphyrin ferrochelatase
     PANA_2331 (hemH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferrochelatase CbiX Glyco_hydro_70 Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADD77498
UniProt: D4GH51
Position
complement(2591801..2592808)
Genome map
AA seq 335 aa AA seqDB search
MFRHFFSMGFQRSQLMTNKQGVLIVNLGTPKEPTTAAVKTFLSKFLHDYRVVDLPRILWC
PILHGVIIPLRAKRVAKLYSSIWMDEGSPLMVYSVRQARALEALTGMPVELGMSYGEPSI
GGAIDKLLAKGVDKIIVIPLYPQFSSSTVSSVWDSVSRHLQTMKNRYTPAINFINDYADH
PAYIEALKASVLESFEANGVPDTLLVSYHGIPVRFSNEGDKYQDRCALTTKLLTEALNMP
SLKIVMTFQSRFGREPWLTPYTDETIKNLPAEGVKNLQVISPGFAADCLETLEELDEQNR
EIFMHAGGTSFTYIPALNDKPVHIEMLRQLAEGAK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaggcactttttttccatgggttttcagaggtcccagctaatgacgaataaacag
ggtgttttaattgttaaccttggaacaccaaaagaacccacaactgctgcggttaaaacg
tttttatctaaatttttgcacgactacagagtggtcgatttacccaggatcctgtggtgc
ccaatcctgcatggcgtgattattccgctgcgcgccaaacgcgtggccaaactgtactcc
tctatctggatggacgaaggttcaccgttgatggtttacagcgttcgccaggctcgcgca
ctcgaagcgctgacgggcatgcctgtcgagttaggaatgagctatggcgagcccagcatt
ggcggcgccattgacaaactgctggccaaaggtgtcgataaaattatcgtcatcccgttg
tatccgcagttttcctcgtccaccgtctcttccgtctgggacagcgtcagccgtcacctg
cagacgatgaaaaaccgttacacgccggcgatcaacttcataaacgattatgccgatcat
cctgcctacatcgaggcgttaaaagcctctgtgctggaatcattcgaggccaatggcgtg
ccggatacgctactggtctcctaccatggcataccggtcaggttttctaacgaaggggat
aagtaccaggatcgctgtgcgttaaccaccaaattgctcaccgaagcccttaacatgcca
tcgttgaagattgtgatgaccttccagtcacgatttggcagagagccctggctaacgccg
tacaccgatgaaaccatcaaaaatcttcctgcggaaggggtaaaaaacctgcaggtgatt
agcccgggttttgcggcagactgcctggaaacgctggaagaactggatgagcagaacaga
gaaatcttcatgcatgcagggggaacgtcctttacctatatccctgcgcttaacgataag
cctgttcacattgagatgctgcgacagctggcagagggcgcgaaatag

DBGET integrated database retrieval system