KEGG   Pantoea ananatis LMG 20103: PANA_2348
Entry
PANA_2348         CDS       T01195                                 

Gene name
rhsD
Definition
(GenBank) RhsD
Organism
pam  Pantoea ananatis LMG 20103
SSDB
Motif
Pfam: RHS_repeat PAAR_motif RHS DUF4150
Other DBs
NCBI-ProteinID: ADD77515
UniProt: D4GHJ8
Position
complement(2611524..2615627)
AA seq 1367 aa
MDNRAARVGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATAAAPLLGAGMAAAGVAA
IGSSCLLSGIIGGVLANAAGISDDITKAADGLGDMIFPPSPAGVIASGSENVHVNGLLAA
RAAGMLTPGDTPPPEPQSPKSFADYGGMLLSAVGQFGSAMWQPTVASADAGASPLEQDKV
ACEKHSAPQYLAQGSKSVFINGQPAVRAKDKTTCDATVSDDVSPNVIIGGETVTVREIKS
GKVPGLAVMMIGLSLIRGRPSQILKNMPCALAGAVGGMMADMAINAAFSSLFPVHASTGV
KVLNDDAERDFSLPGRFPLSFQRSYNSLTQRSGLFGLGWATVFDSYITLDGNQATWFDDN
GRELSFAVPGEKEVLYSISEGLMVRRNELGDIAIADDDGAVWRLYRRTAADPQVLRLASL
SDEYGNALEMGWDEQARLVRIHDAPLAIDVTLHYDDKQHAQRPTSASHFDGEQHWPLTLW
TYNEQGQLASVTDAAGVVSRRFRYNDDGLMIWHQLPGGLESEYRWQKLDHWRVVENRTNT
GDGCHMHYDLDAGITRVSTYDGQQREHHWNAAGLITCFIDERGETWRYEWDENELLTRRI
DPLGNAVSFTYDYLGNRVEEKDADGGVQAVQWLSHRSLPTVVAGADGATTKYYYDPHHGL
ERVVDALGQSTFYKRDEFGLVVEEIDAAGNSYRREFNDAGQVIRETDCSGLTTRYRYHPL
GWLSCVTAPDGEETRYHYDAAGRPVLLERAEGWEERLRWSDNGLPLSHESADGKRSDFRY
DNVGRLIANRNAQGETVQRSWDSRGRLTALQNENGEQYQFEWGADSLLLAQVGLDGVATR
YEYDAAGRTLSRTFAAGHPQAITHRYHWSRAGQLLARTTPEGQTRYHYSGGGQLSKVSQH
LPLSDTEWSQQAEQEIAFTYDALGRIVGEQGEQGALAWDYDALGNCTALTLPDGRNLKQL
YYGSGHLLSIALDNLPVTEFTRDTLHRELSRTQGGLTTRSEYDRLGRLRRRDVFKGEAQR
PAPRVWSRRRDFDYGNNLIREERDDNPFSQTLWHYDNAGRLLSQEGAQPGNEQWRWDGAG
NPLDRHAASHIMHNRVTELNGIRWQYDIHGRTTEKDDGQTRWRYRYDGEHRLTDVISEPR
DRNRPRTKVSFRYDPLGRRISKTRQQLLQGRPSGNAVTTRFVWEGYRLLQEIHDDIPLTY
VYSDSQSYEPLARIDGVESPEIFWFHCAANGTPELLTDVEGQKTWEGVNSPWGKLLRESN
QRIPVVEQNLRMQGQYLDRETGLHYNLFRYYDPDSGRFTQHDPIGLAGGINLYQYAPNAL
GWVDPLGLMIFNGRRKVHSLQGNRLVEHTMLQKGLLNQKNSLIQSLT
NT seq 4104 nt   +upstreamnt  +downstreamnt
atggataaccgtgcggcccgcgtgggcgatgagatcattcattccagcattttcgctgat
atcaccagtattgtcgctgagggcgcagcctacgcggtgatcggtgcggcggtaggtgcg
gcggcaacagcagcagcaccattgctgggggcaggaatggctgcggcaggcgtcgcagcc
attggttccagctgtctgctcagcggcattattggcggtgtattagcgaatgctgcgggc
atttcggatgacatcactaaagcggccgatgggctgggagacatgatattcccgccttct
ccagccggtgtgatcgccagcggatcagagaatgttcacgttaatggtcttttagctgca
cgcgcggccgggatgcttacgcccggagatacgccgccaccggaaccgcaatcgcccaag
agtttcgcagactatggcggcatgctgctctctgcggtgggtcagtttggcagtgcaatg
tggcaacccacggtagcttccgccgacgctggcgcctctccgctggagcaggacaaagtg
gcctgtgaaaagcacagcgcaccgcaatatctggcgcagggatcgaaaagcgtctttatc
aatggccagcctgcggtgcgcgcaaaggataaaaccacctgtgatgccaccgtgagtgac
gatgtttcccccaatgtcatcattggtggtgaaaccgtcacagtaagagagattaaaagt
ggcaaggtgccaggtctggccgtgatgatgatcggcctttccctgattcgtggtcggccc
agccagattctgaaaaacatgccctgcgcacttgctggcgcggtcggtgggatgatggcg
gatatggcgatcaacgccgccttctcatcgctgtttccggttcatgcctccacgggcgtc
aaagtgcttaatgatgatgccgagcgcgatttctcccttcctggccgcttcccgctcagt
ttccagcgtagctataacagcctgacccagcgcagcggattatttggtctgggctgggcg
acggtgtttgacagctatataacgctggatggcaatcaggcgacctggtttgatgacaac
gggcgcgagttgagctttgcggttcccggtgaaaaagaggtgctctacagcatcagcgaa
gggctgatggtaaggcgcaacgaactgggtgatatcgccattgccgacgacgacggtgcg
gtatggcgtctgtacagacgtacggccgcagatccgcaagtgctgcggctggcttcactg
agcgacgaatacggcaatgcgctggagatgggctgggacgaacaggctcgcctggtgcgc
attcatgacgcgccgctggccattgacgttaccctgcattacgacgacaaacagcatgca
cagcgcccgacctcggccagtcactttgatggtgagcagcactggccattaacgctctgg
acttacaatgaacagggccagcttgccagcgtcaccgatgccgcaggtgttgtctcgcgg
cgcttccgttacaacgatgacgggttaatgatctggcatcaactgccgggcgggctggaa
agcgaatatcgctggcagaagctggatcactggcgcgtcgttgaaaaccgcaccaatacc
ggtgacggctgccatatgcattatgatcttgatgctggcatcacgcgcgtatcgacctat
gacggtcagcagcgagaacatcactggaatgctgcagggctcatcacctgctttattgat
gagcggggcgagacctggcgctatgagtgggatgaaaacgaactcctgacgcgccgtatc
gatccgctgggtaatgcggtgagcttcacctatgactatctcggcaaccgtgtagaagag
aaagatgcggacggcggtgtacaggcggtgcaatggctgtcacaccgttctctgcccacg
gtcgttgccggggctgacggtgccaccacgaaatactattacgatccccatcatggcctt
gagcgcgtggttgatgcgctcgggcagagtaccttctataagcgggatgagtttgggttg
gttgtcgaagagattgacgcggcaggcaacagctaccgtcgtgaattcaatgatgccggc
caggttatccgcgaaacagactgttcagggctgacgacgcgctaccgctatcatcccctt
ggctggctcagctgtgtgactgcgccggatggtgaagaaacccggtatcactatgatgct
gcgggccgtcctgttctgctggagcgggcagagggctgggaagagcgattgcgctggagc
gacaacggcctgccactgtcccacgagtcagcggatggtaaacgtagtgacttccgctac
gacaacgtcgggcgcttaatcgccaaccgtaatgcccagggcgagacggttcagcgcagc
tgggacagccgtggtcggttgacggcgctgcaaaacgagaacggcgagcagtatcagttc
gagtggggggcagattccctgttgctggcccaggttgggctggatggcgttgccacgcga
tacgagtatgacgcggcaggacgcacgttatctcgcacctttgccgccgggcatcctcag
gcgattacccatcgctatcactggagccgggcggggcaactgctggcacggaccacgccg
gaaggccagacgcgctatcactacagcggtggtgggcagttaagtaaagtgtcgcagcat
ctgccgctgtctgacaccgagtggagccagcaggccgagcaggagattgcgtttacctat
gatgcgctgggccgcatcgtaggtgagcagggtgaacagggcgcgctggcctgggattac
gacgcgctgggtaactgcacggccttaaccctgccggatggtcgcaacctgaagcagctt
tactacggcagcggccatttactgagcatcgcgctggacaacctgccggtcaccgagttt
acccgtgacacattgcatcgggaactcagccgcacgcagggcggcctgaccacgcgcagt
gagtatgatcggttgggcaggctgcgccgccgtgacgttttcaaaggtgaagcacagcgt
cctgcgccgcgcgtctggtcccgccggcgggacttcgattacggcaacaacctgatccgt
gaagagcgcgacgataacccgttcagccagacattatggcactacgataacgccggtcgg
ctgctgtctcaggaaggcgcgcagccgggtaatgagcagtggcgctgggatggcgcaggc
aacccgctggatcgccatgccgcttcccacatcatgcataaccgcgtcactgaactgaac
ggtatccgctggcagtacgatattcatggccgcaccaccgaaaaggatgacggccagacc
cgctggcgctaccgttacgatggtgagcaccgcctgacggatgtgatcagcgagccacgt
gaccgtaataggccgcgtactaaggtgagtttccgctacgatccgctgggacgtcgcatc
agtaaaacccgccagcagctgttacaggggagaccatctggcaacgccgtcacgacgcgc
tttgtgtgggaaggctaccgcctgctgcaggaaatccacgacgatattccacttacttac
gtctacagcgacagccagagttatgaacctctggcccgtatagatggcgtggaaagcccg
gaaatattctggtttcactgcgccgcgaatggtacgccagagctgctgaccgacgttgaa
ggccagaagacctgggaaggtgtgaacagcccatggggcaaactgctgcgcgagtctaac
cagcgaattccggtggtggagcagaacctgcgtatgcagggccagtacctggatcgtgaa
accgggctgcactataatttgttccgttattatgatccggacagcggccggtttacgcag
catgacccgatagggctggcgggcgggatcaacctttaccagtatgcgccgaatgcgctg
ggctgggtggatccgttggggttaatgattttcaacggaagacgaaaggtgcattctcta
caaggaaacaggctggtcgagcatacaatgctacaaaagggattgttaaaccagaaaaat
tccctgatccagtcacttacttag

DBGET integrated database retrieval system