KEGG   Pantoea ananatis LMG 20103: PANA_2352
Entry
PANA_2352         CDS       T01195                                 

Definition
(GenBank) Hypothetical Protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PANA_2352
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pam02044]
    PANA_2352
Secretion system [BR:pam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PANA_2352
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 Gp5_C bCoV_SUD_C Peptidase_M32
Other DBs
NCBI-ProteinID: ADD77519
UniProt: D4GHK2
Position
complement(2617516..2620086)
AA seq 856 aa
MSMFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPT
DGLLSAVNPRYINGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVP
QIVQTLLKEYGVNVETRLAGSYRVWEYCVQYQESSFDFISRLMELEGIYYFFRHEADKHT
LVLCDAPDQHQAFPGYETIAYHVTPSGGSVTEEGVSQWALSESVTPGMYSTDDYDFRKPN
AWMLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIRQEVWQVEHHMVSGSGTATGI
APGYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFTVLPAAVTYRAK
PETPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAG
QGFGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDG
TADTANALRFEDKAGEEHLWIQAQKNMDTNVKNDETHSVGGERSHYVAKNELHRVEANQS
QAVKGGTEILTGQGKVDAVVEQYVLASGTQLRLVSGESAIELNANGTINLIGKDFNFFVE
NDGHITTGGKLNLNTSGAKPGTSAPGAGHKGDIDAAVQEKFTPGKPDTAGALASAPADAS
NNVANPTRVQTSSFSGYGKDVDNLVEKSPTMKQDITTLKKRGWVFKEGEAGKGTSADRQG
RIITVDKSQMNNAAKVVQSLSHESGHALYKPNIDLSSKNSYLNSTLSDEGAATLNNIRVQ
REIIANQGGDIGIAGNAANQKDYNSIFDSLQKGDITESDARMKIGRIFGKGEQTSTTKEF
YEDYYGGWYDKNYPSK
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgtctatgttctcacgtattactgtacaacttcccgcacaaggactgctgttccgacgt
ctgagcggcagcgaagcgctgtcccagtcgttcgtgctgcaagcggagctgctctccacc
gacgcgcgcattgatcgtaagtcgttgctgggcaagccggtcactttcacgctgccgacg
gatggtctgctgagcgcggtgaatccgcgctacatcaacggcaaaattactcagataggc
gtgcgcagcgaggagctgggcggcgtgcgctacgccgtttacgggctgacggtggagtcg
gatctgtggccgatgaagcgcgaccgcaacctgcgcatcttccagagccagacggtgccg
cagattgtgcagacgctgctgaaggagtacggagtgaacgtggaaacgcgcctggcggga
agctaccgggtgtgggaatactgcgtgcagtatcaggagagcagcttcgactttatcagc
cggctgatggagctggaggggatttactacttcttccggcacgaggcggacaagcacacg
ctggtgctgtgcgacgcgccggaccagcatcaggcgttcccgggctacgaaacgatagcc
taccacgtgacgccgtcgggcggcagcgtgacggaagagggcgtgagccagtgggcgctg
tcggaaagcgtgacgccggggatgtacagcacggacgactacgacttccgcaagccgaac
gcgtggatgctgcaggcgcggcagaacccggtgtcgccgaccccgggctcggtggacgtg
tacgactggccgggtcgcttcgtggagcacggtcacggcgaatactacgcgcgtatccgc
caggaggtgtggcaggtcgagcaccacatggtgagtgggagcggcacggcgacgggcatc
gcgccgggctacactttttcgctgctgaacgcgccgcacttcagcgacaacggcaaatac
ctggtgacgtcggcgcactacgactttgaagagaacagctacgcgagcggcgacgtgggc
gccacgcggcacaacatcgacttcacggtgctgccggcggcggtgacgtaccgtgcgaag
ccggagacgccgtggccgaagacgcacggcccgcagacggcgaaggtggtggggccgaaa
ggcgagagcatctggacggacaaatacggccgggtgaaggtgaagttccactgggaccgt
ctggcgaagggcgacgacacgagttcgtgctgggtgcgcgtatcgagtgcctgggcgggt
cagggcttcggcggggtgcagatcccgcgcgtcaacgatgaggtcgtcgtggacttcatc
aacggcgatccagaccgtccgttgatcattggccgcgtttataacgaagccagtatgccg
ccatgggcactaccggctgccgccacacaaatgggctttctgagtcgctcgaaagacggc
actgcggataccgcgaacgcattacgctttgaggataaggcgggcgaggaacacttgtgg
atccaggcgcagaagaacatggataccaacgtcaaaaatgacgaaacgcacagcgttggt
ggagaacgaagccactatgttgctaaaaatgagctgcatagggttgaagcgaatcagagt
caggctgtaaaaggcggaaccgaaatcctgactggccagggtaaagttgatgccgtagtt
gaacagtatgttctggcgtcgggaacacagttgaggcttgtttctggtgaaagtgctatc
gagctcaatgccaacggaacaataaatcttatcggaaaagattttaacttctttgttgag
aacgatggacatattacgacgggtggcaaactgaatctgaatacgtcgggggctaaacct
ggcacaagtgcgccgggtgcaggccacaaaggcgatattgatgcggccgtacaggagaaa
tttacgccgggaaagcctgatacggcaggtgcgctggcaagcgcacctgccgacgcttca
aataatgtggctaatcccacgcgtgttcaaacatcctcttttagcggttatggcaaagat
gtcgataatttggttgagaaatcacctaccatgaaacaggatatcactacactgaaaaag
cgcggatgggtgtttaaagaaggtgaggcgggcaaggggacttcagcggatcgtcaggga
cgtatcataaccgtcgataaaagccagatgaataacgccgctaaagtcgtccagtcgctg
tcacatgagagtgggcatgcactctataaacccaatattgatctgagttctaagaatagt
tatctgaacagtacactcagtgatgaaggcgctgccacactaaataatattcgtgtacag
cgtgaaatcattgctaatcaggggggagacatcggtatagccggtaatgctgcgaatcag
aaggattacaacagtatcttcgactccttgcaaaaaggtgacataactgagagtgacgca
agaatgaaaattgggcgcatctttggaaagggtgaacagacctccaccactaaggagttt
tacgaagattattatggaggttggtatgataaaaattacccgtcaaagtaa

DBGET integrated database retrieval system