KEGG   Pantoea ananatis LMG 20103: PANA_2357Help
Entry
PANA_2357         CDS       T01195                                 

Definition
(GenBank) Hypothetical Protein
  KO
K11897  type VI secretion system protein ImpF
Organism
pam  Pantoea ananatis LMG 20103
Brite
KEGG Orthology (KO) [BR:pam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pam02044]
    PANA_2357
Secretion system [BR:pam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PANA_2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ADD77524
UniProt: D4GHK7
Position
complement(2627174..2627749)
Genome map
AA seq 191 aa AA seqDB search
MSRNDNSSGDGYSQLHGGYRARKNRDTLTARDKLQSSLLDRLTDDAPDKTTESGNSSIIT
HSTLRRNVLRDLQWLFNTINNEAQHDLSDLTEVQRSVLNFGVAPLAGQNISDIEWQDMQR
KMTDAILHFEPRILPQGLQVRCVSDLTSLSLHNVLSIEIKGRLWCVPYPLEFLFRTQVDL
ESGHFELQDAG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtaatgacaattcgtccggtgacggctattcgcagctgcatggcggctatcgt
gcgcgcaaaaatcgcgacacgctgacggcgcgtgacaaactgcagtcgtccctgctggac
aggctgacagacgacgcgccagataaaaccaccgagtcaggcaacagttcgattattacc
cacagtacgctgcgacgtaatgttctgcgcgatctccagtggttattcaacaccatcaat
aacgaggcgcagcacgatctgagcgacctgacggaggtccagcgttccgtgctgaatttt
ggcgtggcccccctggccggacagaatatctcggacatcgagtggcaggatatgcaacgg
aaaatgaccgatgccattctgcactttgagccacgcattttaccccagggcttacaggtt
cgctgcgtaagcgacctgacctctctgagtctgcacaacgtactatcgattgagattaaa
ggccggttatggtgcgtgccgtacccgctggagtttctgttccgcactcaggttgattta
gagagcggccattttgaactacaggatgcaggttaa

DBGET integrated database retrieval system