KEGG   Pantoea ananatis LMG 20103: PANA_2367
Entry
PANA_2367         CDS       T01195                                 

Definition
(GenBank) Hypothetical Protein
  KO
K11902  type VI secretion system protein ImpA
Organism
pam  Pantoea ananatis LMG 20103
Brite
KEGG Orthology (KO) [BR:pam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pam02044]
    PANA_2367
Secretion system [BR:pam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PANA_2367
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ADD77534
UniProt: D4GHL7
Position
complement(2637492..2638589)
AA seq 365 aa
MIRQAVQSRDETDFIPRCLNPEAKRMSIDIDTLLIPVSHDNPCGENLEYDADFQAMEQAS
VGKAEQQFGNTIIPAEPADWNKVEKLALELMSRSKDLRVMLTLTHAWTRLKGLPGYAQGL
QLIEQAMLQFWEPLWPRLEEDGEHDPFYRINALAVLGDQSALTAAVRQSWLMRYASDGIT
LRDASALCDGSKTEVPDYPGGLPRLNDELARGEQPGIAAIQNIAERLQNIRRIVIEKLDE
TALPDMSQLQRSMAMLNERCQATDMESLHSLAAAMQSAPATEQQPSVAAPRAATDWRSAQ
LNSRAEAQLMLEKVKQYFSQHEPSHPAPLMIDRVQRLIELDFMDIIRDLAPDGVHQLENI
FGRRD
NT seq 1098 nt   +upstreamnt  +downstreamnt
ttgatccggcaggcggtgcaaagccgggacgaaacggactttatcccccgatgtttgaat
cctgaggcgaagcggatgagtattgatattgacacgttgctgataccggtaagccatgat
aatccgtgcggtgaaaacctggagtacgacgcggactttcaggcgatggagcaggccagc
gtgggaaaagccgaacagcagttcggtaacaccattattccggctgagccagcggactgg
aacaaagttgaaaagcttgcactggaactgatgagccgcagcaaagacctgcgtgtcatg
ctgaccctgacacatgcctggacgcgcctgaaagggttaccgggctatgcacagggcctg
caactgattgaacaggcgatgttgcagttctgggaaccgctctggcctcgccttgaagaa
gatggcgagcacgatccgttttaccgcatcaacgcgctggctgtgctgggcgatcagtcg
gcacttacggccgccgttcgtcagtcatggctcatgcgctatgcgtccgatggtattacg
ctgcgtgatgcttcggcgctgtgtgacggcagtaaaacagaggtgccagattatccgggt
gggctgccgcgtctgaatgacgaacttgcacgaggggaacaaccgggcatcgcagcgatt
caaaacattgctgagcgtttgcaaaatattcgccgcatcgtgattgaaaagctggatgaa
acggccttgccggatatgagtcagctgcaacgcagcatggcaatgctgaatgagcgctgt
caggccacggatatggaatcgttacactccctggcggcggcgatgcaatccgcacccgca
acggagcagcagcccagcgtcgctgcaccacgtgcggctaccgactggcgcagtgcccaa
ctgaattcgcgggcagaagcccaacttatgctggaaaaggtcaaacagtactttagtcag
catgagccgagccacccggcaccgctgatgattgacagggtacagcgccttatcgaactc
gattttatggacatcattcgcgatctcgcgcccgatggtgtgcatcagttagaaaacatt
tttggacgccgcgactaa

DBGET integrated database retrieval system