KEGG   Pantoea ananatis LMG 20103: PANA_2398Help
Entry
PANA_2398         CDS       T01195                                 

Gene name
phnG
Definition
(GenBank) PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00440  Phosphonate and phosphinate metabolism
pam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PANA_2398 (phnG)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     PANA_2398 (phnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnG
Motif
Other DBs
NCBI-ProteinID: ADD77565
UniProt: D4GHP8
Position
complement(2673717..2674166)
Genome map
AA seq 149 aa AA seqDB search
MKQQTARQHWLSVLAHSSAAELDAYWQPLNLKPEFTLIRPAEIGLTRLQARMGATGKRFV
VGDATVTRAVVRLNDGTLGYSYLLGRDKAHAERCALMDALLQQADTAELLQEKMIIPLAA
SREEQRQLRAREIASSKVDFFTLVRGDNE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcaaacggcccgccagcactggctttcggtgttggcacacagcagcgcagcc
gagcttgacgcgtactggcagccgctcaacctcaagcccgaatttaccctgattcgcccg
gccgagattggcctgacgcgtctgcaggcccgcatgggcgccaccggcaaacgctttgtg
gtgggcgatgccaccgtgacgcgtgcggtggtgcggctgaacgacggcaccctgggttac
agctatctgctcggccgggataaagcccatgccgaacgctgcgccctgatggatgccctg
ttgcaacaggccgacaccgctgaactgctgcaggaaaaaatgattatcccgctggcggcc
tcacgtgaagagcagcgtcagctgcgcgcacgtgaaatcgccagcagcaaagtggacttc
tttacgctggtacgcggagacaatgaatga

DBGET integrated database retrieval system