KEGG   Pantoea ananatis LMG 20103: PANA_2447
Entry
PANA_2447         CDS       T01195                                 

Definition
(GenBank) Hypothetical Protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PANA_2447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pam02044]
    PANA_2447
Secretion system [BR:pam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PANA_2447
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADD77614
UniProt: D4GHU7
Position
complement(2728452..2728934)
AA seq 160 aa
MAIDIYLKVEGTTGESQDSNHKGWTDVLSFNWGASQPGNMAVGGGGGSGKVNFNDLRVKA
LIDKSTAAILKYCSSGKHVSKVELSVCKAGGNQIEYTKIVLEDVLVTATDFNGVGQGDTI
VVDYAFQASKVSTSYWEQSASGTKGAESKAGWDIKQNKES
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcgattgatatttatttgaaagttgaagggactactggagaatcacaggacagcaat
cataaaggatggaccgacgtgctctcatttaactggggggcttcgcaacccggtaatatg
gcggtaggtggcggtggcggctcaggaaaagtgaatttcaacgatctgcgtgttaaagcg
ttaatcgacaaatccactgctgccattcttaaatactgctccagcggaaagcatgtttca
aaggtagaactgtcggtttgcaaagccggtggcaaccaaattgagtacacgaagattgtg
ctggaagatgtactggttacggcaacggattttaacggagtagggcaaggtgacaccatt
gtggtggactacgcctttcaggcatccaaagtgtctaccagctactgggaacaaagtgcc
agcggtaccaaaggggcggaaagcaaagccggttgggatattaaacaaaataaagagagc
tga

DBGET integrated database retrieval system