KEGG   Pantoea ananatis LMG 20103: PANA_2472Help
Entry
PANA_2472         CDS       T01195                                 

Gene name
hisH
Definition
(GenBank) HisH
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00340  Histidine metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01230  Biosynthesis of amino acids
Module
pam_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PANA_2472 (hisH)
Enzymes [BR:pam01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     PANA_2472 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase SNO Peptidase_C26 GATase_3 GATase_5
Motif
Other DBs
NCBI-ProteinID: ADD77639
UniProt: D4GHX2
Position
2755159..2755749
Genome map
AA seq 196 aa AA seqDB search
MNVVILDTGCANLSSVKWAVERLGYAPEVSRHPDVVLRADKLFLPGVGTAQAAMNQLLER
ELIELVKACTQPVLGICLGMQLLGSHSEENGGVPTLGIIDHPVSLMDTQGLPLPHMGWNQ
ITAQAGNHLFRGIDEGSYFYFVHSYAMPVNASTIAQCHYGQAFTAAVQKDNFFGVQFHPE
RSGKVGAQLLKNFLEM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggtgatcctggatacgggctgtgccaacctgtcgtcggtaaaatgggctgtt
gagcgtctgggctacgcgccggaagtcagccgtcatcctgacgtggtgctgcgcgccgat
aagctgtttttgccgggcgtgggcaccgcgcaggccgcgatgaaccagctgctggagcgc
gagctgattgagctggtcaaggcctgtacgcaaccggtattgggtatttgtctgggtatg
caactgctgggcagccacagtgaagagaacggtggcgtgccgacgctgggcattatcgac
catcctgtctcgctgatggatacacagggattaccgcttccccacatgggctggaaccag
attaccgctcaggcgggcaatcatctgtttcgcggcatcgacgaaggcagctatttctat
ttcgtccacagctatgccatgccggtgaatgccagcaccattgcccagtgccactatggc
caggcctttaccgccgcagtgcagaaagataacttctttggcgtgcagttccacccggaa
cgctctggcaaagtgggcgcacagttgctgaaaaacttcctggagatgtga

KEGG   Pantoea ananatis LMG 20103: PANA_2474Help
Entry
PANA_2474         CDS       T01195                                 

Gene name
hisF
Definition
(GenBank) HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00340  Histidine metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01230  Biosynthesis of amino acids
Module
pam_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PANA_2474 (hisF)
Enzymes [BR:pam01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     PANA_2474 (hisF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth ThiG Dus NMO TMP-TENI FMN_dh Oxidored_FMN G3P_antiterm NanE PcrB IMPDH
Motif
Other DBs
NCBI-ProteinID: ADD77641
UniProt: D4GHX4
Position
2756468..2757244
Genome map
AA seq 258 aa AA seqDB search
MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYAEEGADELVFYDITASSDDRV
VDKSWVSRVAEVIDIPFCVAGGIKTPEDAARILEFGADKISINSPALADPSLITRLADRF
GVQCIVVGIDTWFDDASGKYHVNQYTGDESRTRVTQWETLDWVQEVQKLGAGEIVLNMMN
QDGVRNGYDLVQLKKVRDVCKVPLIASGGAGTMAHFLEAFEQANVDGALAASVFHKQIIN
IGELKRFLIDNGVEIRAC
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaaaacggataattccctgtcttgatgtacgcgacggtcaggtggttaagggc
gttcagtttcgcaaccatgaaattattggcgatatcgtgccgctggcgcagcgctatgcg
gaagaaggtgccgatgaactggtgttttatgatatcaccgcctcatcggacgaccgcgtt
gtagacaaaagctgggtttcacgcgtggcggaggttatcgacattcctttctgtgtggcc
ggcggcattaaaaccccggaagatgcggcccggattctggagtttggcgcggataaaatc
tccattaactcccctgctctggccgatccttcgttgattacccgcctggctgaccgcttt
ggcgtgcagtgcattgtggtgggcattgatacctggttcgatgatgccagcggtaaatat
cacgttaaccagtatacgggcgatgaatcccggacgcgcgtcacccaatgggaaacgctg
gactgggtacaggaagtgcaaaagctgggcgcaggcgaaattgtcctgaatatgatgaat
caggacggcgtacgcaacggctatgacctggtgcagctcaagaaagtccgtgacgtgtgc
aaggtgccgctgattgcttctggcggagccggtaccatggcccacttccttgaggccttt
gagcaggccaacgttgacggtgcccttgcggcttcggtgtttcacaaacagattattaat
atcggcgagctgaaacgctttctgatcgacaacggtgtggagattcgcgcgtgttaa

DBGET integrated database retrieval system