KEGG   Pantoea ananatis LMG 20103: PANA_2473Help
Entry
PANA_2473         CDS       T01195                                 

Gene name
hisA
Definition
(GenBank) HisA
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00340  Histidine metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01230  Biosynthesis of amino acids
Module
pam_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PANA_2473 (hisA)
Enzymes [BR:pam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     PANA_2473 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus Trp_syntA IGPS NanE NMO PcrB TMP-TENI IMPDH DUF3376 G3P_antiterm Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: ADD77640
UniProt: D4GHX3
Position
2755746..2756486
Genome map
AA seq 246 aa AA seqDB search
MMIIPALDLIDGKVVRLHQGDYAQQRDYGSDPLPRLQDYAGQGATVLHLVDLTGAKDPAK
RQIALLKKLLNGVEAVVQVGGGIRNRDDVKALLDAGASRVVVGSTAVKQPEEVKAWFNEF
GPDAIVLALDVRIDAANRKEVAISGWQEASGITLEEVIEQFQPVGLKHVLCTDISRDGTL
SGSNVDLYKEVTARFPQIAFQSSGGIGELSDIAALRGSGVQGVIVGRALLEGKFTVSEAI
ACWQNG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgatgattatccccgctttagatttaatcgatggcaaggtcgtgcgcctccatcagggt
gattatgcgcaacagcgtgattacggcagcgatccgctgccccggttgcaggactacgcc
ggccagggggcaacggtattgcaccttgttgatctgaccggtgccaaagatccggctaaa
cgccagattgccttactgaagaagctgctcaacggcgttgaggcggtcgtgcaggttggc
ggcggtatccgtaaccgggatgacgtaaaagcgttgctggatgccggtgccagccgggtg
gtggtcggttcgactgccgtcaaacagcctgaggaagtcaaagcctggtttaacgaattt
ggcccggacgccatcgtgctggcgctggacgtgcgcatcgatgcggcgaaccgcaaagag
gtcgccatcagcggctggcaggaagcgtccggtatcacgctggaagaggtcatcgaacag
tttcagcccgttggcctgaagcatgttctgtgcacagatatttcccgtgacggtacgctc
agcggttctaacgtcgacctgtataaagaagtgaccgcacgttttccacagattgcgttt
cagtcttcgggcggtattggtgaactcagtgatattgccgccttacgcggtagcggcgtt
cagggcgtgattgtcggacgtgcgctgctggaaggtaaatttacagtttcggaggcaata
gcatgctggcaaaacggataa

DBGET integrated database retrieval system