KEGG   Pantoea ananatis LMG 20103: PANA_2492Help
Entry
PANA_2492         CDS       T01195                                 

Gene name
manC
Definition
(GenBank) ManC
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00051  Fructose and mannose metabolism
pam00520  Amino sugar and nucleotide sugar metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PANA_2492 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_2492 (manC)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     PANA_2492 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 AraC_binding Cupredoxin_1
Motif
Other DBs
NCBI-ProteinID: ADD77659
UniProt: D4GIC5
Position
complement(2776017..2777432)
Genome map
AA seq 471 aa AA seqDB search
MLLPVIMAGGTGSRLWPLSRELYPKQFICLHGEHSMLQETVTRLTGIEARAPMVICNEEH
RFLVAEQLRQINKLSHNIILEPVGRNTAPAIALAALNAVEQGDDPVLLVLAADHVIEDRV
AFHEAIEVATAYAKQGKLVTFGIVPSGPETGYGYIQRGEILPGAENGPWKVQRFVEKPNK
NTAEQYLESGEYYWNSGMFMFRAKRYLQELEKFRPDILEACRNAMANVKEGKDFISINKD
DFIACPDESVDYAVMEQTDAAVVVPLAAGWSDVGSWSALWEVNEKDVHGNSLKGDTFLHN
TKNCYINSEDQLVAAIGVENLVIVNTKDAVLVARKDQVQDVKRVVEFLKGECRSEYRRHR
ETYWPWGRCDLVVNTGRFNVNRITVKPGESFELQMHYHRTEHWVILSGTAKVTIQDKTLL
LTENQSTFIPIGHPHTLENPGKIPLELLEIQSGSYLGDDDLILIKQQFASK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttcccgtaatcatggccggaggaaccggcagccgcttatggcccctttcgcgt
gagctttatcctaaacagttcatctgcctgcatggtgaacactccatgctacaagaaacc
gttacccgactaacgggcattgaagctcgggcacctatggttatctgcaacgaagagcat
cgctttttagtggcagagcagctgcgacagatcaacaagttgtcgcataacatcatttta
gagccagtgggcagaaatactgcacctgcaatcgccttagctgcactgaatgctgtggag
cagggagatgatcctgtcctactggtacttgctgcggaccacgttattgaagatcgtgtt
gccttccatgaggccatagaggtcgctaccgcctatgctaaacagggcaaactagtgact
ttcggtatcgtaccttcaggaccggaaacgggatatggctacattcagcgtggtgaaatt
ctgccgggcgcagaaaacggcccctggaaagttcagcgttttgtcgaaaaacctaataag
aatacagctgagcaatatctggagtcgggcgaatactactggaatagcggaatgttcatg
tttagagcaaaacgctatctccaggaacttgaaaaattccgcccggatatactggaagcc
tgtcgtaacgcaatggctaatgtgaaagaaggtaaagatttcatcagcatcaacaaagat
gattttatcgcctgccccgatgagtcggttgattatgcagtaatggaacaaactgatgct
gcagtggtagtaccattagctgcgggatggagcgatgtcggttcctggtcagcgctatgg
gaagtgaacgaaaaagatgttcatggtaactcccttaaaggtgacaccttccttcacaac
actaaaaactgttatatcaatagtgaagaccaactagtggcagctataggtgtggaaaac
ctggtaatcgtaaacaccaaagacgccgtattggttgcacgcaaagatcaggtccaggat
gttaagcgcgtggttgagtttctgaaaggcgaatgtagaagcgagtaccgtcgtcaccgc
gaaacttactggccgtggggccgctgtgatttggtagtaaatactggtcgtttcaacgta
aaccggatcacagtaaaacccggggagtcatttgagttacagatgcattatcaccgtaca
gagcactgggtgattctttcgggaacagcgaaagtcacaattcaggacaaaacactgtta
ttaactgaaaatcagtcaacgtttattcctattggtcatccccataccttagaaaaccca
ggtaagattccattagaacttctggaaattcagtcaggatcatacctaggtgatgatgac
ctgattttgattaaacaacagtttgctagtaagtaa

DBGET integrated database retrieval system