KEGG   Pantoea ananatis LMG 20103: PANA_2664Help
Entry
PANA_2664         CDS       T01195                                 

Gene name
purF
Definition
(GenBank) PurF
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam00250  Alanine, aspartate and glutamate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_2664 (purF)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA_2664 (purF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pam01002]
    PANA_2664 (purF)
Enzymes [BR:pam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     PANA_2664 (purF)
Peptidases and inhibitors [BR:pam01002]
 Cysteine peptidases
  Family C44
   PANA_2664 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4 hnRNP_Q_AcD
Motif
Other DBs
NCBI-ProteinID: ADD77831
UniProt: D4GJ81
Position
complement(3000925..3002442)
Genome map
AA seq 505 aa AA seqDB search
MCGIVGITGFMPVNQSIYDALTVLQHRGQDAAGICTIDALNCFRLRKANGLVSDVFEARH
MQRLQGNMGIGHARYPTAGSSSASEAQPFYVNSPYGISLAHNGNLTNAHELRKQLFEKGR
RHVNTTSDSEILLNIFAQELDRFQHYPLEADNVFAAIAAVHQQVRGAYAVVAMIIGHGMV
AFRDPNGIRPLVLGKRVIADGRTEYMVASESVALDTLGFEFIRDVAPGEAVYITEQGQLS
TRQCAENPKNNPCLFEYVYFARPDSFLDKISVYSARVRMGTKLGQKIAREWEDLDIDVVI
PIPETSMDTALEIARILDKPYRQGFVKNRYVGRTFIMPGQQLRRSAVRRKLNANRAEFRD
KNVLLIDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEVRFPNVYGIDMPSATELIAHG
REVEEIRQIIKADALIFQDLDDLIEAVREENPDIVQFECSVFNGIYVTKDVDQGYLEYLE
SLRNDDAKAIARQNEVENLELHNEG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgtcggtatcaccggtttcatgccggtcaaccagtcgatctatgacgcg
ttaacggtgctccagcaccgtgggcaggatgccgcaggcatttgtaccatcgatgcgctg
aactgcttccgcctgcgtaaggctaatggtctggtcagcgatgttttcgaagcgcgtcat
atgcaacgtttacaaggcaacatggggattggtcacgcacgctatcctaccgcgggcagc
tccagcgcttctgaagcccagccattctacgttaactcgccgtacggtatttcccttgcc
cataacggtaacctgaccaatgcccacgagctgcgtaagcagctgttcgaaaaaggccgt
cgtcacgttaataccacctccgattctgaaatcctgttgaatatctttgcgcaggaactg
gatcgttttcagcactatccgctggaagccgataacgtgtttgccgccatcgctgccgtc
caccagcaggtgcgtggcgcctatgccgtggtggcgatgatcatcggtcacggcatggtc
gccttccgcgatcctaacggcattcggccactggtgctgggcaaacgcgtcattgccgat
ggccgtaccgagtacatggtcgcctccgaaagcgtggcgctggataccctgggttttgaa
tttatccgtgacgtggcaccgggtgaagcggtttacatcactgagcaggggcagctttca
acccgtcagtgtgccgaaaatccaaaaaacaatccttgcctgttcgaatacgtctatttt
gcgcgtccggactccttcctggataagatttcggtctacagcgcccgcgtgcgcatgggc
accaagctgggtcagaagatcgcccgcgagtgggaagatctggatatcgacgtggtgatt
cccattccggaaacctcgatggataccgcgctagaaatcgcccgcatccttgataagcct
taccgtcaggggtttgtgaaaaaccgctacgtgggccgcacctttatcatgccgggccag
caactgcgccgcagcgccgttcgccgcaagctcaacgctaaccgcgctgagttccgcgat
aagaacgtgctgctgattgatgactcaattgttcgtggcaccacctccgagcagattatc
gagatggcgcgagaggcgggcgcgaaaaaggtctatcttgcgtctgccgcgccggaagtg
cgctttcctaacgtctacggcattgatatgcccagcgcgaccgagctgattgcccacggc
cgtgaagtggaagagattcgccagattatcaaagcagatgcgctgattttccaggatctc
gatgaccttatcgaagccgtacgggaagagaacccggatatcgtgcagtttgagtgctcc
gtctttaacggcatctacgtgacgaaagacgtcgatcagggctatcttgaatatctggaa
tccctgcgtaacgacgatgcgaaagccatcgcccgtcaaaacgaagttgaaaacctcgaa
ctgcataacgaagggtaa

DBGET integrated database retrieval system