KEGG   Pantoea ananatis LMG 20103: PANA_2754Help
Entry
PANA_2754         CDS       T01195                                 

Gene name
gltX
Definition
(GenBank) GltX
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00860  Porphyrin and chlorophyll metabolism
pam00970  Aminoacyl-tRNA biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
Module
pam_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
pam_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PANA_2754 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PANA_2754 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pam01007]
    PANA_2754 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pam03016]
    PANA_2754 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:pam02048]
    PANA_2754 (gltX)
Enzymes [BR:pam01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     PANA_2754 (gltX)
Amino acid related enzymes [BR:pam01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   PANA_2754 (gltX)
Transfer RNA biogenesis [BR:pam03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PANA_2754 (gltX)
 Prokaryotic type
   Other AARSs
    PANA_2754 (gltX)
Prokaryotic defense system [BR:pam02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    PANA_2754 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADD77921
UniProt: D4GJV3
Position
complement(3092572..3093990)
Genome map
AA seq 472 aa AA seqDB search
MKIKTRFAPSPTGFLHVGGARTALYSWLFARHHQGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLSLDWDEGPYYQTKRFDRYNAVIDEMQEAGTAYKCYCSKERLEALRETQMANGEKPR
YDGRCRDSHEHHAADEPHVVRFRNPQEGSVIFDDQIRGPIEFSNQELDDLIIRRTDGSPT
YNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKAIGAQVPVYAHVSMILGDDGKKLSK
RHGAVGVMQYRDDGYLPEALLNYLVRLGWSHGDQEIFSVKEMTALFSLDAVSKSASAFNT
EKLQWLNHHYINALPPEYVATHLQWHIEQQNIDTRTGPELAKLVTLLGERCKTLKEMAAS
CHYFYQDFSEFDADAAKKHLRPVARQPLEVVRDKLAALTDWNAETVHQAIQQSADELGVG
MGKVGMPLRVAVTGAGQSPGLDVTVEAIGRSRSVERIEKALAFIAEREAQSQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaactcgcttcgcgccaagccctaccggcttcttacacgtaggtggcgct
cgtaccgcactctactcatggctctttgcccgtcatcatcagggcgagtttgtactgcgc
attgaagataccgatcttgagcgttctacaccggaagccatcgaagccattatggatggg
atgaactggctgagcctggactgggatgaaggcccttattaccagaccaaacgcttcgac
cgctacaacgccgtcattgatgaaatgcaggaagcgggtactgcctataaatgttactgc
tcgaaagaacgtcttgaagcgctgcgtgaaacgcagatggccaacggcgaaaaaccccgc
tatgacggccgctgccgtgacagccatgagcatcatgccgctgatgagccgcatgtagtg
cgcttccgtaatccacaggaaggctctgttatttttgacgatcagattcgcggtccgatt
gagttcagtaaccaggagctggacgatctgattatccgccgtaccgatggctcaccgact
tacaacttctgcgtcgtggtcgatgactgggacatgggcatcacccacgttgtgcgcggt
gaagaccacatcaacaacaccccgcgtcagatcaatatcctgaaggcgataggcgcacag
gtaccggtttatgcccacgtttcgatgattctgggtgacgacggtaagaaactgtctaaa
cgtcatggtgcagtaggcgtgatgcaataccgtgatgacggctatctgccagaggcgttg
cttaactatctggtacgtctgggctggtcacatggcgatcaggaaattttctctgtcaaa
gagatgacggcgctgtttagcctggacgcggtcagtaaatcggccagcgcctttaatacc
gaaaaactgcagtggctaaatcaccactatattaatgcgctgccgcccgagtacgtggca
acccatctgcagtggcatattgaacagcagaacattgatacccgcactggcccggaactg
gcaaagttggtgaccttgctgggcgagcgctgcaagacgctgaaagagatggccgcatcg
tgtcactatttctatcaggatttttcagaattcgatgccgatgccgcgaaaaagcattta
cgtccagtcgcgcgtcagccgctggaagtggttcgcgacaagctggccgcattgactgac
tggaatgcagaaacggtgcatcaggctattcagcagagcgcggatgagctgggtgtgggc
atgggcaaagtcggcatgccgctgcgcgtcgccgtcaccggcgccggtcagtctcccgga
ctggatgtgacggtggaagccattggccgtagccgcagcgttgagcgtattgaaaaagca
ctggcctttattgctgagcgtgaagcacagagccagtaa

DBGET integrated database retrieval system