KEGG   Pantoea ananatis LMG 20103: PANA_2883Help
Entry
PANA_2883         CDS       T01195                                 

Gene name
purL
Definition
(GenBank) PurL
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_2883 (purL)
Enzymes [BR:pam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     PANA_2883 (purL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_5 AIRS_C FGAR-AT_N FGAR-AT_linker AIRS
Motif
Other DBs
NCBI-ProteinID: ADD78050
UniProt: D4GKL1
Position
complement(3245561..3249451)
Genome map
AA seq 1296 aa AA seqDB search
MMEILRGSPALSAFRVNKLLARFQDAHLPVSDIYAEYVHFADVSAPLSEDEKSRLQRLLK
YGPSLAEHAPQGRLILVTPRPGTISPWSSKATDIAHNCDLSQVRRLERGMAFYVQAPQLS
ESQWQTLSALLHDRMMETVYSDFSEAEQLFAHHEPQPVKSVDVLGEGRQALVQANMTLGL
ALADDEIDYLLAAFTRLGRNPNDIELYMFAQANSEHCRHKIFNADWIIDGEKQPKSLFKM
IKNTFEQTPDYVLSAYKDNAAVMEGSEVGRFFADAEKGEYAYYQEAAHILMKVETHNHPT
AISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNLRIPGFEQPWEEDFGKPARIV
SALDIMTEGPLGGAAFNNEFGRPALNGYFRTYEEQVNSHNGTELRGYHKPIMLAGGIGNI
RADHVQKGEITVGAKLVVLGGPAMNIGLGGGAASSMASGQSDADLDFASVQRDNPEMERR
CQEVIDRCWQRGDDNPILFIHDVGAGGLSNAMPELVSDGGRGGRFNLRDILSDEPGMSPL
EVWCNESQERYVMAVAPEKLAEFAAICQRERAPYAVIGEATEEQHLTLNDSHFDNSPIDM
PLDVLLGKNPENDARCGETAGEGRCPAARGHYADGRGKSRAALANRSGKNLPDHHRRSQR
NRHGGARSDGGPLADPCCYCAVTTASLDSYHGEAFALGERAPVALLDFAASARLAVGEAL
TNLAATPVGSLKRVKLSANWMSAAGHPGEDAGLYDAVKAVGEELCPALGITIPVGKDSMS
MKTRWQEGTEQREMTSPLSLVITAFARVEDVRRNVTPQLVADRDNLLLLIDLGNGANTLG
ATALAQVYRQLGDKPADVRDATQLAGFFNAIQALVSQQKLLAYHDRSDGGLLVTLAEMAF
TGHCGIEVDIAAQGSDALAALFTEELGAVIQINAADRESVEQILAEHGLAHCSHVLGSAQ
SGDRFVIRSGDSAVYSESRTTLRTWWAETTWQMQRLRDNPACADQEHQAKQDDTDPGLNV
SLTFKPDEDVAAPMIATGARPRVAVLREQGVNSHVEMAAAFDRAGFTAVDVHMSDLLAGR
SDLEPFQALVACGGFSYGDVLGAGEGWAKSILFNPRVRDQFESFFHRPQTLALGVCNGCQ
MMSNLRELIPGSELWPRFVRNQSERFEARFSLVEVAASPSLLLDGMAGSRMPIAVSHGEG
FVEVRDGAHLAALESKGLVALRYVDNTGKVTEAYPANPNGSPNGITAVTNESGRVTIMMP
HPERVFRTVSNSWHPAEWGEDSPWMRIFRNARKQLG
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaattctgcgtggttcgcccgccctgtcggcatttcgtgtaaacaaattgctg
gcccgctttcaggacgctcatctgccggtgagtgatatttacgctgagtacgtccatttt
gccgatgtcagcgcgccgctgagtgaggatgaaaaatcccgtctgcagcgcctgctcaag
tacggtccttctctcgctgaacatgcgccacaagggcgtttaattctggtcacgccacgt
cctggtacgatatcgccgtggtcatcaaaagccacagacattgctcataactgcgatctt
tcgcaggtgcgtcgtctggaacgaggcatggccttttatgtccaggcacctcagctttct
gaaagccaatggcaaacgctctccgcactgctgcacgaccgcatgatggaaacggtttac
agcgatttcagcgaggctgagcagctgtttgctcaccatgaacctcagccggtcaaaagc
gttgatgtgctgggtgagggccgtcaggcgctggttcaggccaatatgacgctcggcctg
gcgctggccgacgacgaaattgactacctgctggcggcctttacccggctgggacgcaat
ccgaacgacattgaactttatatgtttgcccaagcgaactctgagcactgtcgccacaaa
atctttaacgctgactggatcatcgacggcgaaaaacagcctaaatcactgtttaaaatg
attaagaacaccttcgagcaaacgccggattatgttctgtcagcctataaagataacgcg
gcggtaatggaaggctcggaggtcggtcgcttcttcgcggacgcagaaaagggtgagtac
gcctattaccaggaagccgcgcacattctgatgaaggttgaaacgcacaaccacccaacc
gcgatttcgccctggcctggcgcggcaaccggctccggcggtgaaattcgtgatgaaggc
gccacggggcgcggtgccaagccgaaagcgggcctggtcgggttctcggtgtcgaacctg
cgcatccccggcttcgaacagccctgggaggaggattttggcaagccagcgcgcatcgtc
agcgcgctggatattatgaccgaaggcccactgggcggcgcagcctttaacaacgaattt
ggtcgtccggccttaaacggctacttccggacctatgaagagcaggttaacagccacaac
gggactgaactgcgcggctaccacaagcccattatgctggctggcggcatcggaaacatt
cgtgcggaccacgttcagaaaggtgaaatcaccgtcggggccaaactggtcgtgctgggc
gggccggcgatgaatatcggcctgggcggcggtgcggcatcatccatggcatcaggccag
tccgatgcggatctcgactttgcatcggtgcagcgtgacaaccctgaaatggagcgtcgc
tgccaggaagtgatcgaccgttgctggcaacggggcgatgacaacccgattttgtttatc
cacgatgtgggcgcgggcggcctgtccaacgccatgccggaactggtcagcgacggtgga
cgcggcggtcgcttcaacctgcgcgacatcctgagtgatgaacccggaatgagcccgctt
gaagtctggtgtaacgaatcacaagagcgctatgtgatggccgtggcccctgaaaagctg
gccgagtttgctgccatttgtcagcgcgaacgtgcgccgtatgcggtgattggtgaagcc
accgaagagcagcacctgaccctgaacgacagccactttgataacagcccgattgatatg
ccgctggacgtcctgctgggcaaaaaccccgaaaatgacgcgcgatgtggtgaaactgca
ggcgaagggcgatgccctgcagcgcgagggcattacgctgacggacgcggtaaatcgcgt
gctgcacttgccaaccgtagcggaaaaaaccttcctgatcaccatcggcgatcgcagcgt
aaccggcatggtggcgcgcgatcagatggtgggcccctggcagatccctgttgctactgc
gccgttacgacggccagtctcgacagctaccatggcgaagccttcgcgctgggcgagcgt
gcgcctgtcgcgctgctggacttcgccgcctcggcccgtctggccgtgggtgaagcgctg
actaacctggcggcgacgccggtcggttcgctgaagcgcgtgaaactctcggctaactgg
atgtctgcagcaggccatccgggggaagatgcgggcctgtatgacgctgtaaaagccgtc
ggtgaggaactgtgtccggcgctcggcatcactatcccggtgggtaaagactctatgtcg
atgaaaacccgctggcaggaaggcaccgaacagcgcgaaatgacctcgccgctgtcgctg
gtgatcacggcttttgcaagggtagaagacgtacgtcgcaatgtgacgccacagctggtc
gccgatcgggacaacctgctgctgttaatcgaccttggcaacggcgctaacaccttaggc
gcgacggcgctggctcaggtttatcgtcaactgggcgacaagcctgctgatgtccgtgat
gcaacgcagctggctggcttctttaatgccattcaggccctggtcagccagcaaaaactg
ctggcttaccatgaccgctcagacggcggcctgctggttaccctggcggaaatggctttc
accggtcactgtggcatcgaagtcgatatcgcggcgcagggcagcgatgcactggctgcg
ctgttcaccgaagagctgggggcggtgattcaaatcaacgcggcggatcgcgaatccgtg
gagcagattcttgctgaacatggcctggcgcactgcagccatgtgctgggcagcgcacag
tcgggcgatcgctttgtgattcgctcaggcgacagcgcggtttacagcgaaagccgcacc
accttgcggacctggtgggcagaaaccacctggcagatgcagcgtctgcgtgataacccg
gcctgtgccgatcaggaacatcaggcaaagcaggatgacaccgatcccgggctgaacgtt
agtctgacctttaagccagacgaagacgttgcggcaccgatgattgcaacgggtgcgcgt
ccacgcgttgccgtgctgcgcgagcagggcgttaactcgcatgtggaaatggcggccgcc
tttgatcgggcaggttttacggcggttgacgtgcatatgagtgacctgctggcgggccgg
agcgatctggaacctttccaggcgctggtggcctgtggcggtttctcctacggtgacgta
ttgggcgcgggtgaaggttgggcgaaatccattctgtttaacccgcgcgtacgcgatcag
ttcgagtcgttcttccatcgcccacaaacgctggcactgggcgtgtgtaacggctgccag
atgatgtctaacctgcgtgaattgattccgggtagtgagctgtggccgcgctttgtccgt
aaccagtctgaacgttttgaagcacgcttcagcctggttgaagtagctgccagcccgtcg
ttactgttggatggcatggccggttcccgtatgccgatcgccgtatcgcacggcgagggc
ttcgtggaggtgcgtgatggcgcgcaccttgccgcactggaatcgaaagggctggtggcg
ctgcgttatgtcgataacacaggcaaagtgacggaagcctatccggcaaacccgaatggc
tcgccaaacggtattactgcggtgaccaatgaaagtggacgcgtcacaattatgatgccg
catccagagcgtgtgttccgcacggtcagcaactcatggcacccggctgaatggggcgaa
gacagcccctggatgcgcattttccgcaatgcacggaaacaattgggttaa

DBGET integrated database retrieval system