KEGG   Pantoea ananatis LMG 20103: PANA_3006Help
Entry
PANA_3006         CDS       T01195                                 

Gene name
pssA
Definition
(GenBank) PssA
  KO
K00998  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00260  Glycine, serine and threonine metabolism
pam00564  Glycerophospholipid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Module
pam_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PANA_3006 (pssA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_3006 (pssA)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     PANA_3006 (pssA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 PLDc
Motif
Other DBs
NCBI-ProteinID: ADD78173
UniProt: D4GKY4
Position
3370742..3372100
Genome map
AA seq 452 aa AA seqDB search
MMLSKFKRNKHQQHLAQLPKLSQSVADVSTLYSPAEFRETLLEKIASAQSRICIVALYLE
NDDAGRAVMNALYAAKLARPQLDISILVDWHRAQRGRIGAARGVTNADWYCEMAQQHPDH
VIPVYGIPVNTREALGVLHLKGFIIDDTLLYSGASLNDVYLHQHDKYRYDRYQLIRNPAL
ADTMFEWINHHLKDAEAVNRLDYAERPSSPEIKNETRQFRQDLRGFNYQFEGNAGNDELT
VTPLVGLGKRSLLNKTIFHLMPCAEKKLTICTPYFNLPALLVRNIIGLLRQGRDVEIIVG
DKTANDFYIAPDQPFKIIGALPYLYEINLRRFLSRLQYYVSNGQLTVRLWKDGENSYHLK
GMWVDDEWQLITGNNLNPRAWRLDLENAVLIHDPHQQLAEQRQHELMLIRQHTTVVGHFR
ELESIADYPAKVRKLIRRLRRIRIDRLISRIL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgatgttgtctaaatttaaacgcaataaacaccaacaacacctcgcacagctgcctaaa
ctgtcacaatctgttgcggatgtgtcgacgctttattcgcccgccgaatttcgtgagacg
cttttggaaaagattgcgtcagcgcaatcgcgcatttgtatcgtcgcactctatctggaa
aatgacgatgcgggccgcgccgtcatgaatgcactgtatgctgcgaaactcgctcgccca
cagctcgacatcagtattttagtcgactggcaccgtgcccaacgtggccgtattggtgct
gcacgaggcgtgaccaatgccgactggtattgtgagatggcccaacagcatcccgaccac
gtcattcctgtctacggcattccggttaatactcgcgaggcactcggagtactgcatctg
aaaggcttcatcattgatgatacgctgctctacagcggggccagcctgaatgacgtttac
ctgcatcagcacgataaatatcgctacgatcgctaccagctcattcgtaatcccgcgctg
gccgataccatgtttgaatggatcaaccaccatttaaaagacgccgaggccgtcaatcgc
ctggactatgctgagcgtccttccagtccggaaattaaaaatgaaacgcgtcagtttcgt
caggacctgcgcgggttcaactatcagtttgaaggcaacgccggcaacgatgaactcacc
gtgacgccactggtcggcctgggcaagcgtagcctgctgaacaagaccattttccatttg
atgccctgcgctgaaaagaagctcaccatctgcacgccttatttcaacctgcctgcgctg
ctggtgcgcaatatcattggcctgctacgtcaggggcgtgacgttgagatcatcgtgggt
gataaaacagcgaatgacttctatatcgcacccgatcagccatttaagatcatcggtgca
ctgccctacctctacgaaattaacctgcgtcgctttttaagccggctgcagtactacgtt
agcaacgggcagctgaccgtacgtttatggaaagacggtgaaaacagctatcacctgaaa
ggaatgtgggttgacgatgagtggcagctcattacaggcaacaatcttaatccccgcgcc
tggcggctggatctcgagaatgcggtactgatccacgatccgcatcagcagttggccgaa
caacgacagcatgagctgatgctgatccgtcaacataccacggtcgttggacactttcgc
gagctggagagcatcgctgactacccggcgaaagtgcgtaagctgattcgccgtctacgc
cgtattcgtattgaccgcctcatcagccgcatactgtaa

DBGET integrated database retrieval system