KEGG   Pantoea ananatis LMG 20103: PANA_3015Help
Entry
PANA_3015         CDS       T01195                                 

Gene name
pheA
Definition
(GenBank) PheA
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
pam_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_3015 (pheA)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     PANA_3015 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     PANA_3015 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2
Motif
Other DBs
NCBI-ProteinID: ADD78182
UniProt: D4GLC9
Position
3387643..3388830
Genome map
AA seq 395 aa AA seqDB search
MDSLQVSLMTPDNPLLALRDKISAVDEKLLTLLAERRLLAVEVAKSKLATHRPVRDVERE
RALIEHLIVLGKKHQLDAHYITRLFQLVIEDSVLTQQALLQKNLNHTHAHAARIAFLGPK
GSYSHLAARQYAARHFSNMVECGCLKFHDIIKQVENNAADYAVLPIENTSSGSINDVYDL
LQQTNLSIVGELTLPIEHCMLVSSQSDLEQIETVYSHPQPFQQTSHFINRFPHWKIVYTE
STAAAMEKVAALNSPKVAAIGSEAGGELYQLQVLERNLANQQQNHTRFIVLARKPIEVSD
QISAKTTLIMATGQQAGALVDALLVLRQHNLIMSKLESRPINGNPWEEMFYLDVQGNLQS
EKMQQALEELRAMTRSLKVLGCYPSENIIPVEPDK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttggatagcttacaggtgagccttatgaccccggacaatccgcttctggcactgcgtgat
aaaatcagcgccgttgatgaaaaactactgacgttacttgctgaacggcgtttgctggcc
gtggaggttgcaaagtcgaagctggcaacgcaccgccctgtccgcgacgtcgaacgtgaa
cgcgcactgattgagcacctcatcgtactgggtaaaaaacatcagttggatgcgcactac
attacccgcctgtttcagttagtgattgaagattcggttctgactcagcaggccttgctg
caaaaaaacctcaaccatacgcatgctcatgcggcccgcatcgccttcttaggcccgaaa
ggctcttactctcatctggctgcccgtcagtatgccgcgcgtcatttcagtaacatggtt
gaatgcggttgcctgaaatttcatgacattatcaagcaggtggagaataacgcggcggat
tacgccgtcttaccgatcgagaataccagctccggttcaatcaacgatgtgtacgacctg
ctgcaacagaccaacctctctatcgtaggggaactgacgcttccgattgagcactgcatg
ttggtcagtagccagagcgacctggaacagattgaaacggtctacagccatccgcagcct
tttcagcagaccagccacttcattaaccgcttcccgcactggaagattgtctacaccgaa
agcaccgccgctgccatggaaaaagtggccgcgctcaactcacctaaggtcgcggcgatc
ggtagcgaagccggtggcgagctgtatcagttacaggtgctggagcgtaatctggccaac
caacagcagaatcacacacgctttattgtcctggcccgtaagcccatcgaagtatccgat
cagatttcggcgaaaacgacgctgatcatggcaaccggccagcaggcgggtgcactggtt
gacgcactgttggtcttgcgccagcacaacctgattatgagcaaactggaatcccggcct
atcaacggtaacccgtgggaagagatgttttatctggatgtgcagggcaatctgcagtct
gaaaagatgcagcaggcattagaagagctgagggcaatgacgcgttcgttaaaagtactt
ggctgttaccccagcgaaaatatcattcctgttgaacccgacaagtaa

KEGG   Pantoea ananatis LMG 20103: PANA_3365Help
Entry
PANA_3365         CDS       T01195                                 

Gene name
pheC
Definition
(GenBank) PheC
  KO
K01713  cyclohexadienyl dehydratase [EC:4.2.1.51 4.2.1.91]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_3365 (pheC)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     PANA_3365 (pheC)
    4.2.1.91  arogenate dehydratase
     PANA_3365 (pheC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ADD78532
UniProt: D4GN40
Position
complement(3756873..3757685)
Genome map
AA seq 270 aa AA seqDB search
MSPYQRKLTAEKNTMMKKTLVITLLLVAGGAQAQSRLDSVLNTKTLKVCTTGDYKPYSFL
KPDGSYEGLDISMAESLAASLGAKVQWVPTTWKTLMQDFIAKQCDIALGGVSVTLKRQQT
AWFAQPLGVDGKIPLVRCADKAKYQTVEQMNQPSVRLVEPAGGTNEAFVHSHLPQAALTL
FHDNVTIFQQLVDNKADVMITDASEALYQQKRFPSLCALNPDKPLQYGEKAYMIPRDDMS
WKQYVDQWLHLSTATGEYAQIAQQWMGVMK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccataccagcgcaaactcactgccgaaaaaaatacaatgatgaaaaaaacactc
gtaatcacgttactgctggtggctggcggcgcgcaggcccagtcgcgtctggacagcgtt
cttaacaccaaaactctgaaagtctgtactaccggggactacaaaccttacagcttcctg
aaaccggatggcagctatgaagggctggatatcagcatggctgaatccctggccgcgtca
ctgggggcgaaggtgcaatgggtacccaccacctggaaaaccctgatgcaggactttatc
gcgaagcagtgcgatatcgccttgggtggcgtatcggtcacgctgaagcgccagcaaacg
gcctggtttgcgcagccgttaggcgtggacggtaaaattccgctggtgcgatgcgccgat
aaggcgaagtaccagacggtcgaacagatgaaccagcccagcgtgcgtctggttgagcca
gcagggggcacgaacgaggcgtttgttcacagccacttacctcaggctgcgttaacgctg
tttcacgataatgtgaccatcttccagcagctggtggacaataaagccgatgtgatgatc
accgatgcctcagaggcgctgtatcagcaaaaacgctttccttccctgtgtgcgctcaac
ccggataaaccgctgcagtacggtgaaaaagcttacatgattccgcgtgatgatatgagc
tggaagcagtatgtcgatcagtggctgcacctgagcaccgcgaccggggaatatgcgcag
atcgcccagcagtggatgggtgtgatgaagtaa

DBGET integrated database retrieval system