KEGG   Pantoea ananatis LMG 20103: PANA_3197Help
Entry
PANA_3197         CDS       T01195                                 

Gene name
rpiA
Definition
(GenBank) RpiA
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00030  Pentose phosphate pathway
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pam_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA_3197 (rpiA)
Enzymes [BR:pam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     PANA_3197 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ADD78364
UniProt: D4GM96
Position
complement(3570368..3571102)
Genome map
AA seq 244 aa AA seqDB search
MHPSIFSKPCFILRAFPYRTGSKHIMTQDELKKAVGWAALDYVQPGTVVGVGTGSTAAHF
IDALGSIKHQIEGAVSSSEASTQKLKSLGIQVFDLNEIDDLAIYVDGADEINPQMQMIKG
GGAALTREKIVAAVAKKFICIADASKEVDVLGRFPLPVEVIPMARSYVARELVKLGGLPE
YRQNVVTDNGNIILDVHNLRILDPIELEKTINALPGVVTVGLFATRGADVALIGGPDGVK
TLKK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgagcattttcagcaagccttgctttatactacgcgcatttccttatcgcaca
ggttctaaacatatcatgacccaggatgaactgaaaaaagctgttggttgggccgcactg
gattatgtgcagcccggtactgtcgtcggcgtcggtacgggttctacggccgctcacttt
atcgatgcgctcggcagcattaaacatcagattgagggggccgtatccagttccgaagcg
tcgacgcaaaagctaaaaagcctgggcattcaggtgtttgatttgaacgagattgatgat
ctggccatttatgtcgatggtgccgatgaaattaacccacaaatgcagatgatcaaaggg
ggcggtgctgccttaactcgcgagaaaatcgtcgcggcggtcgccaaaaagtttatctgt
atcgccgacgcatccaaagaagtggacgtgcttggacgcttcccgttgccggttgaagtt
atcccgatggcgcgaagctatgtcgcgcgtgaactggtgaagctgggcggtttgcctgaa
tatcgtcagaatgtggtgactgacaacggtaatatcattcttgatgtgcacaatctgcgt
attctcgatcccattgagctggaaaaaacgattaatgccctgcctggcgtcgtcactgtg
gggctgttcgccacgcgtggcgcagatgtcgcattgattggcggacctgacggtgtcaaa
accctcaaaaaataa

DBGET integrated database retrieval system