KEGG   Pantoea ananatis LMG 20103: PANA_3377Help
Entry
PANA_3377         CDS       T01195                                 

Gene name
ribB
Definition
(GenBank) RibB
  KO
K02858  3,4-dihydroxy 2-butanone 4-phosphate synthase [EC:4.1.99.12]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00740  Riboflavin metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Module
pam_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PANA_3377 (ribB)
Enzymes [BR:pam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     PANA_3377 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: ADD78544
UniProt: D4GN52
Position
complement(3767905..3768561)
Genome map
AA seq 218 aa AA seqDB search
MNQTLLSEFGTPKQRVERAIAALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIR
HGSGIVCLCLTEERRQQLALPMMVENNTSAYGTGFTVTIEAAKGVTTGVSAQDRITTIRT
AIADNAKPEDLNRPGHVFPLRAHDGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDG
SMAHAPEVILFAKQHAMPVVTIEDLVAYRREHETRQAS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagactctactttctgaatttggcacgccgaaacagcgtgtagaacgtgctatc
gccgcactccgtgaaggacgcggtgtgatggtgctcgacgatgaagatcgtgaaaacgaa
ggcgatatgattttcgctgccgaaaccatgaccgtcgagcagatggctctcaccattcgc
cacggcagcggtatcgtgtgtctctgcctgaccgaagaacgccgccagcagctggcatta
ccgatgatggtggaaaacaacaccagcgcctatggcacagggtttaccgtgaccatcgaa
gcggcgaagggcgtcaccaccggcgtatccgcgcaggatcgcatcactaccattcgcacg
gcgattgccgataacgccaaacccgaagatctgaaccgtccgggccacgtttttcccctg
cgtgcccatgatggtggtgttctgacccgcggcggtcatactgaagcgaccatcgatctg
gtcacgctggcgggctttaaacctgcaggcgtcctgtgtgaactgaccaacgacgacggc
tctatggcgcatgcgcctgaagtgatcctgttcgcgaaacagcatgcgatgccggtcgtg
acgattgaagatctggttgcctatcgtcgtgagcacgaaacgcgtcaggccagctaa

DBGET integrated database retrieval system