KEGG   Pantoea ananatis LMG 20103: PANA_3538Help
Entry
PANA_3538         CDS       T01195                                 

Gene name
miaA
Definition
(GenBank) MiaA
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pam01006]
    PANA_3538 (miaA)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pam03016]
    PANA_3538 (miaA)
Enzymes [BR:pam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     PANA_3538 (miaA)
Prenyltransferases [BR:pam01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   PANA_3538 (miaA)
Transfer RNA biogenesis [BR:pam03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    PANA_3538 (miaA)
 Prokaryotic type
    PANA_3538 (miaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPPT IPT AAA_33 AAA_16 Zeta_toxin AAA_18 TIP49 Cytidylate_kin Hydin_ADK PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ADD78705
UniProt: D4GP00
Position
complement(3934682..3935632)
Genome map
AA seq 316 aa AA seqDB search
MSELNQAGRPKAIFLMGPTASGKTALAIELRKHLPVELISVDSALIYRQMDVGTAKPSAE
ERAQAPHRLLDIRDPAEAYSAAEFRRDALAEMADIVQHGRIPLLVGGTMLYFKALLEGLS
PLPSADPEVRQKIEQMANERGWEALHRQLCEIDPVAGSRIHPNDPQRLSRALEVFFISGK
TLTELTKISGEALPYDVHQFAIAPANRELLHQRIALRFDQMLASGFEAESRALFARGDLH
TDMPSIRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQLAKRQMTWLRGWENIHWLDSDEP
HSARDTVLKVVSAKHG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgaaccaggctggccggccaaaggcaatatttttgatggggcctacagcg
tcaggcaaaaccgcattagcgatcgaattgcgcaagcacttacctgtagagcttatcagc
gtagattcggctctgatttatcgtcagatggatgtcggtacggcaaaaccctctgcagaa
gagcgggcgcaggcgccccatcgtttgctggacattcgcgatcctgccgaagcctattcg
gcggcagagttccggcgggatgcgttagcagaaatggcggatatcgttcagcatggacga
attccgttgcttgttggtggaactatgctctacttcaaggcgttacttgaaggattgtcg
ccgctgccctcggccgatccggaggttcgtcaaaaaatagagcaaatggcgaatgaaaga
ggctgggaagctttacatcgtcaactttgcgaaattgatccggtcgcaggcagtcgtatt
catccgaatgatccgcagagactttcgcgagcactggaagttttttttatttcgggtaaa
actttaacggaactgacaaaaatttctggtgaagcgttaccctacgatgtgcatcagttt
gctatcgcccccgcgaaccgcgaactgttgcatcaacgcatcgcactgcgttttgatcag
atgttggcgtcaggatttgaagcggagtctcgggccctgtttgcacgaggtgatttgcat
acggatatgccttccattcgttgtgttggctatcgccagatgtggtcgtatttggctggc
gagatcgattacgacgaaatggtttatcggggagtttgcgcaacccggcaactcgctaaa
cgccagatgacctggttacgtggttgggaaaatattcactggctagacagtgatgaacct
cactcagcgcgtgatacagtactgaaggttgttagtgcgaagcatgggtga

DBGET integrated database retrieval system