KEGG   Pantoea ananatis LMG 20103: PANA_3664Help
Entry
PANA_3664         CDS       T01195                                 

Gene name
rpe
Definition
(GenBank) Rpe
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00030  Pentose phosphate pathway
pam00040  Pentose and glucuronate interconversions
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pam_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA_3664 (rpe)
   00040 Pentose and glucuronate interconversions
    PANA_3664 (rpe)
Enzymes [BR:pam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     PANA_3664 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C PGM_PMM_II His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADD78831
UniProt: D4GCM0
Position
complement(4050578..4051273)
Genome map
AA seq 231 aa AA seqDB search
MENRMKQYLLAPSILSADFARLGEDTAKALAAGGDVVHFDVMDNHYVPNLTMGPMVLKAL
RDYGITAPIDVHLMVKPVDALIPEFAKAGATYITFHPEASEHVDRTLQLIKEHGCKAGLV
FNPATPLSYLDYVMDKLDIILLMSVNPGFGGQSFIPGTLDKLREARKRIDQSGYSIRLEV
DGGVKIDNIGQIAAAGADMFVAGSAIFGHPDYKKVIDDMRNELEKANGSFH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggagaatcggatgaaacaatatttgctggccccttccatcctttcggcagactttgct
cgcctgggtgaagacactgcgaaagcactggcggccggaggcgacgtggttcacttcgac
gttatggacaaccactatgttcccaatctgaccatgggaccgatggtactgaaagcgttg
cgcgattacggtattacggccccaatcgatgtgcatttaatggtgaagcccgtggatgcg
ttaattcccgagtttgccaaagctggtgccacctacattactttccacccggaagccagc
gagcatgttgaccgtacgctgcagttgatcaaagagcacggttgcaaagccggcctggtc
ttcaatcccgccacgccgctcagctaccttgattacgtgatggataagctggatatcatt
ctgctgatgtcggtgaaccctggcttcggcgggcagtcatttattcccggcaccctggat
aagctacgtgaagcgcgtaagcgcatcgatcagagcggctacagcattcgtctggaagtg
gacggcggcgtgaagattgataatattggccagatcgccgcagcaggcgcggatatgttt
gtggccggttcagccatctttggccatccggactataaaaaagtaatcgatgacatgcga
aacgagctggagaaagccaatggctcatttcactga

DBGET integrated database retrieval system