KEGG   Pantoea ananatis LMG 20103: PANA_3699Help
Entry
PANA_3699         CDS       T01195                                 

Gene name
glgC
Definition
(GenBank) GlgC
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00500  Starch and sucrose metabolism
pam00520  Amino sugar and nucleotide sugar metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Module
pam_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
pam_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PANA_3699 (glgC)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_3699 (glgC)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     PANA_3699 (glgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Fucokinase Hexapep
Motif
Other DBs
NCBI-ProteinID: ADD78866
UniProt: D4GD41
Position
complement(4093030..4094376)
Genome map
AA seq 448 aa AA seqDB search
MVPHTLCVCSKSNDKESDMVKLERAEHLMLARQLPTQTVALVLAGGRGTRLVDLTAKRAK
PAVHFGGKFRIIDFALSNCVNSGIRRIGVITQYQSHTLTQHIQRGWSIFNEEMNEFVDLL
PAQQRFSTEQWYRGTADAVTQNLDVIRRYGAQYVVILAGDHIYKMDYSRMLLDHVLNDAR
CTIACLPVPVHEATAFGVMAVDENNKVIDFVEKPPKPPTMPGDDTKSLASMGIYVFDAEY
LYGLLEADLHEAGSSHDFGKDILPKVVASGEGYAHSFAISCVQNDHEAPPYWRDVGTLEA
YWRANLDLASVTPELDMYDSTWPIRTHMEPLPPAKFVQDRSGSHGMTMNSLVSGGCIISG
SVVVNSVMFSRVRVNSFCNIDSTVLLPDVVVGRSCRLRRCVIDRACVLPEGMVIGENPDE
DSRRFFRSEEGIVLVTRAMLAKLNSAGS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggtcccgcacacgctgtgtgtgtgttccaaaagcaatgataaggagtcagacatggtc
aaattagaaagagcagaacatctcatgctggcgcgccagctccctacacaaaccgttgcc
cttgtactggctggtggacgcggtacgcgtctggtcgatcttaccgctaagcgtgccaag
cccgccgttcactttggtggcaaattccgcattatcgactttgcactttccaactgtgtg
aactcagggattcgccgcattggggtcattacgcaataccagtctcatacgttaactcaa
catattcagcgtggttggtctatcttcaacgaagagatgaatgaatttgttgacctgcta
cctgcgcagcagcgcttctcgacggagcaatggtatcgcggaacagcggatgcagtaaca
cagaaccttgacgttatccgacgctatggcgcgcagtacgtcgtcatcctggccggtgat
catatctataagatggattactcaaggatgttgctggaccacgtgctgaacgatgcgcga
tgcaccatcgcctgtctgcccgtgccggtgcatgaggcgaccgcatttggtgtgatggcc
gtcgacgaaaacaataaagtaatcgatttcgtagagaagccgccgaagccaccgacaatg
ccgggcgatgacaccaaatcgctggccagtatgggaatttatgtcttcgacgccgaatac
ctctatggcttgctggaagccgacctgcatgaagcaggttcaagccacgatttcggcaaa
gatattctgccaaaagtggtcgcgagtggagagggctacgcccattcgtttgcgatctct
tgtgtgcaaaacgatcacgaggcaccgccctactggcgggatgtgggtacgctggaagcc
tactggcgcgccaaccttgatttagcctctgttacacccgagctggacatgtacgacagc
acctggccgattcggacgcacatggaacctttgccaccggcaaagtttgttcaggaccgt
tccggcagccatggtatgacgatgaactcactggtctccggtggctgcattatctcggga
tcggtggtggtgaattcggtcatgttttcccgcgtgcgggtgaactcattttgcaatatc
gattcaacggtactgctacctgatgtggtagtcggccgatcctgtcgtctgcgccgctgc
gtcattgaccgcgcctgtgtgctgccagaagggatggtgattggtgaaaaccctgatgaa
gacagccgccggtttttccgttcagaagaaggcattgtactggttacgcgcgccatgctg
gccaaactaaatagcgcgggatcataa

DBGET integrated database retrieval system