KEGG   Pantoea ananatis LMG 20103: PANA_3823Help
Entry
PANA_3823         CDS       T01195                                 

Gene name
ilvC
Definition
(GenBank) IlvC
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00290  Valine, leucine and isoleucine biosynthesis
pam00770  Pantothenate and CoA biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01210  2-Oxocarboxylic acid metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
pam_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PANA_3823 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PANA_3823 (ilvC)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     PANA_3823 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C AdoHcyase_NAD ApbA NAD_binding_7 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADD78990
UniProt: D4GDU8
Position
complement(4230598..4232073)
Genome map
AA seq 491 aa AA seqDB search
MANYFNTLNLRNQLAQLGKCRFMGRDEFADGASFLKGKKIVIVGCGAQGLNQGLNMRDSG
LDVSYTLRAEAIAEKRASFRKATENGFKVGTYEELIPQADLVVNLTPDKQHSAVVQAVQP
LMKDGAALGYSHGFNIVEVGETIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VAEGHDAAYTEKLIQFGWETITESLKFGGITLMMDRLSNPAKLRAYALSEQLKGIMAPLF
QKHMDDIISGDFSAGMMADWANDDKKLLTWREETGKTAFETAPQFDGKIEEQEYYDKGVV
MVAMVKAGVELAFETMVDAGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFSFAAVPLLKEFMTTLQPGDLGKAIEGTQVDNAQLRDVNEAVRQHPIEQVGRKLRGY
MTDMKRIAVAG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggctaattacttcaatacactgaatctgcgcaaccagttagcgcaactgggcaaatgt
cgttttatggggcgtgacgaattcgcggatggcgccagcttcctgaaaggcaaaaagatt
gtgattgtgggctgtggtgctcagggtctgaatcagggcctgaacatgcgtgattcgggt
ctggatgtgtcctatacgctgcgtgcagaagccatcgctgaaaaacgtgcctcattccgt
aaagcgacagaaaatggttttaaagttggcacttacgaagaactgattccacaggcggac
ctggtggtcaacctgacgccggacaaacagcactccgccgttgttcaggctgtacagcca
ctgatgaaagacggtgccgcgctgggctattcacacggtttcaacattgttgaagtgggc
gaaaccatccgtaaagacatcaccgtcgtgatggttgcgccgaagtgccccggcaccgaa
gtgcgtgaagaatacaagcgtggtttcggtgttccgacgctgatcgcggttcacccggaa
aacgatccaaaaggtgaaggcatggcgatcgccaaagcctgggcttctgccaccggtggc
gaccgtgctggcgtgctggaatcctctttcgttgcggaagtgaaatctgacctgatgggt
gagcagaccattctatgcggcatgctgcaggccggttctctgctgtgcttcgacaagctg
gtggcagaaggtcacgatgcggcatacaccgaaaaactgattcagtttggctgggaaacc
atcaccgaatccctgaagtttggtggcattacgctgatgatggatcgcctgtcgaatccg
gccaaactgcgtgcttacgcgctgtctgagcagctgaaaggcatcatggcccctctgttc
cagaagcacatggatgacatcatttccggcgatttctctgcgggcatgatggccgactgg
gctaacgacgataagaaactgctgacctggcgcgaagagaccggtaaaaccgcgttcgaa
accgcacctcagttcgatggcaaaatcgaagagcaggagtactacgataaaggcgttgtc
atggttgcgatggtcaaagcgggcgttgagctggcatttgaaacaatggttgatgcaggc
atcatcgaagagtcggcttactacgaatcgctgcatgagctgccgctgattgccaacacc
attgcccgtaagcgcctgtacgaaatgaacgtggtgatttctgataccgctgagtacggt
aactatctgttctccttcgcggccgttccactgctgaaagagttcatgaccacgctgcag
ccgggcgatctgggcaaagccattgaaggcactcaggtggataacgcacagctgcgcgac
gttaacgaagccgttcgtcagcatcctatcgagcaggtaggtcgcaaactgcgtggctac
atgacggatatgaaacgcatcgcggttgcgggctaa

DBGET integrated database retrieval system