KEGG   Pantoea ananatis LMG 20103: PANA_3827Help
Entry
PANA_3827         CDS       T01195                                 

Gene name
ilvE
Definition
(GenBank) IlvE
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00270  Cysteine and methionine metabolism
pam00280  Valine, leucine and isoleucine degradation
pam00290  Valine, leucine and isoleucine biosynthesis
pam00770  Pantothenate and CoA biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01210  2-Oxocarboxylic acid metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
pam_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
pam_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PANA_3827 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    PANA_3827 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    PANA_3827 (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PANA_3827 (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pam01007]
    PANA_3827 (ilvE)
Enzymes [BR:pam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     PANA_3827 (ilvE)
Amino acid related enzymes [BR:pam01007]
 Aminotransferase (transaminase)
  Class IV
   PANA_3827 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4 DUF2735
Motif
Other DBs
NCBI-ProteinID: ADD78994
UniProt: D4GDV2
Position
complement(4236576..4237505)
Genome map
AA seq 309 aa AA seqDB search
MSTKKADFIWFNGEMVKWEEAKVSVMSHALHYGTSVFEGVRCYDSHKGPVVFRHREHMQR
LHDSAKIYRFPIKHSIDELMEACREVIRVNNLKSAYIRPLAFVGDVGLGVNPPDGFTTDV
IIAAFPWGAYLGAEALENGIDAMVSSWNRVAPNTLPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDTNGLISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIITLARDMGIEVREQ
TLSRESLYLADEVFMSGTAAEITPVRSVDRIQVGAGKCGPVTKRVQQAFFGLFTGETEDK
WGWLDPVNA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaagaaagcagactttatttggttcaacggcgaaatggttaagtgggaagag
gcaaaagtcagcgtgatgtctcacgctttgcactacggcacatcggtatttgaaggcgtt
cgctgctatgactcccataaagggccggttgtattccgtcaccgtgagcacatgcagcgc
ctgcacgattccgccaaaatctaccgtttcccaatcaaacacagcattgatgaactaatg
gaagcctgccgtgaagtcattcgcgtcaacaacctgaaaagcgcctatatccgcccgctg
gctttcgtcggtgatgtgggactgggcgtgaacccgccggatggctttacgaccgacgtg
atcattgcggccttcccgtggggcgcttatctgggtgctgaagcgctggaaaacggtatt
gatgcgatggtttcttcatggaaccgtgttgcgcccaatacgctgccaaccgcggcgaaa
gcaggcggcaactacctttcctcactgttagtgggcagcgaagcgcgccgccatggttat
caggaaggcattgcactggacaccaatggcctgatctcagaaggcgcaggcgaaaacctg
tttgaagtgaaagacggtgtgctgttcaccccgccgtttacctcatctgcactgccgggc
atcacccgcgatgccattattacgctggcgcgtgatatgggcatcgaagtacgtgaacag
acgctgtcccgtgagtcgctctatctggctgatgaagtctttatgtctggcaccgcagct
gaaattaccccagtgcgtagcgttgaccgcattcaggttggcgcaggcaaatgcggcccc
gtcaccaaacgcgttcagcaggccttcttcggcctgttcaccggcgagactgaagacaaa
tggggctggctggacccggttaacgcataa

DBGET integrated database retrieval system