KEGG   Pantoea ananatis LMG 20103: PANA_3840Help
Entry
PANA_3840         CDS       T01195                                 

Gene name
argH
Definition
(GenBank) ArgH
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00220  Arginine biosynthesis
pam00250  Alanine, aspartate and glutamate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01230  Biosynthesis of amino acids
Module
pam_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA_3840 (argH)
   00220 Arginine biosynthesis
    PANA_3840 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pam04147]
    PANA_3840 (argH)
Enzymes [BR:pam01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     PANA_3840 (argH)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PANA_3840 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-ProteinID: ADD79007
UniProt: D4GDW5
Position
complement(4256908..4258296)
Genome map
AA seq 462 aa AA seqDB search
MKEIHMALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVNVLTGDEQ
QQLEAALNALLEEVRANPEQILQSDAEDIHSWVEGQLIEKVGALGKKLHTGRSRNDQVAT
DLKLWCKEQVAALLGATRELQQALVATAEVNQDAVMPGYTHLQRAQPVTFAHWCLAYVEM
LARDESRLQDTLKRLDVSPLGCGALAGTAYDIDREQLAGWLGFASATRNSLDTVSDRDHV
LELLSDASIGMVHLSRFAEDMIFFNTGEAGFIELSDKVTSGSSLMPQKKNPDALELIRGK
CGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMSVLVLDGLQVKRPR
CQEAAEQGYANSTELADYLVAKGVPFREAHHIVGETVVEAIKQGVALEALTLAQLKQFSS
VIEDDVYPVLALKSCLDKRNAQGGVSPGQVARAIADAKTRLA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggagattcacatggcactttggggtggacgctttacccaggcagcagatcaacgt
ttcaaacagttcaacgactcgctgcgttttgattaccgcctggctgagcaggacatcatt
ggctcagtggcctggtccaaagcgctggtgacggtaaatgttctgaccggtgatgagcag
cagcagctggaagccgcattgaatgcattgctggaagaggttcgtgccaatcctgagcaa
attctgcaaagtgatgccgaagatattcacagctgggttgaaggccagttgatcgagaaa
gtcggcgcgctgggcaaaaaactgcacaccggccgtagccgtaatgaccaggtagccacc
gacctgaagctgtggtgtaaggagcaggtcgccgcactgctgggggccacacgtgagctg
cagcaggcgctggtcgccaccgccgaagtgaaccaggacgcggtgatgccgggctatacg
catttgcagcgggcgcagccggtgacctttgcgcattggtgcctcgcctatgttgaaatg
ctggcgcgcgatgaaagccgtttgcaggatacgttgaagcgtcttgatgttagcccactg
ggttgtggcgcgctggcaggaacggcgtatgacatcgatcgtgagcagctggctggctgg
ttaggttttgcttctgccacacgtaacagcctggacaccgtgtccgatcgtgaccatgtt
ctggaactgctctcggatgcgtcaatcggtatggtacatctgtcgcgctttgctgaagac
atgattttcttcaacacaggcgaagccggctttatcgaactctcagataaagtcacctcg
ggttcatccctgatgccacagaagaaaaacccggatgcgctagagctgattcgcggcaag
tgtggccgtgtacagggcgcgttaaccggaatgatgatgacgctgaaaggcctgccgctc
gcctacaacaaagacatgcaggaagacaaagaagggctgttcgacgcgctggatacctgg
ctggactgcctgcatatgtcggtccttgtcctggatggcctgcaggtgaaacgtcctcgc
tgccaggaagcggcagagcagggatacgctaactcaaccgagctggctgactacctcgtt
gccaaaggcgtgccgttccgtgaggcgcaccacattgtcggtgaaacggtcgttgaagcg
ataaaacagggcgtggcgctggaagcactgacgctggcgcagttaaagcagttcagtagc
gtgatagaggacgatgtctatcctgttctggccctaaaatcctgtctggataagcgtaat
gcgcagggtggggtttcgcccggtcaggttgcccgtgctatcgcggatgccaaaacacgc
ttagcgtaa

DBGET integrated database retrieval system