KEGG   Pantoea ananatis LMG 20103: PANA_4072Help
Entry
PANA_4072         CDS       T01195                                 

Definition
(GenBank) DUR1,2
  KO
K01941  urea carboxylase [EC:6.3.4.6]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00220  Arginine biosynthesis
pam00791  Atrazine degradation
pam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PANA_4072
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    PANA_4072
Enzymes [BR:pam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.6  urea carboxylase
     PANA_4072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CT_A_B CPSase_L_D2 CT_C_D Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 HlyD_3 ATP-grasp ATP-grasp_3 HlyD_D23 RimK ATP-grasp_5 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADD79239
UniProt: D4GFB9
Position
complement(4518594..4522199)
Genome map
AA seq 1201 aa AA seqDB search
MFDTLLIANRGAIACRILRTLRAMQVKGVAVYAEADLGSLHIRDADEALSLGDGPAAQTY
LAAEKIIAAAQQSGAQAIHPGYGFLSENAGFAEACEAAGLIFVGPTPQQLRTFGLKHTAR
ALAKAEGVPLLEGSELLADAAEACRVAETVGYPVMLKSTAGGGGIGMRVCRDSHELTEAF
DTVQRLGQNNFSDAGVFLENYIERARHLEVQIFGDGQGDVIALGVRDCSVQRRNQKVIEE
TPAPNLPEGMAQALCEAAVALGKAVNYRSAGTVEFVYDSLNQQFYFLEVNTRLQVEHGVT
EQVWGVDLVKWMIELAADTLPPLRELAAGLAPQGHAIQARIYAEDPGRQFQPSPGLLTDV
AFPDQQDARLRIDHWIEAGCEVPPFFDPLLAKTIAWRPSRPEAIATLAQALAETRLYGVE
TNRLYLQQILAFAPFVQGEPWTRCLEQLSYQAATVEVLGAGTQTSVQDYPGRLGYWAVGV
PPSGPMDDRALRSGNRLLGNDEGEAALEMTLTGPTLKFNTAIQAVICGAPLSATLDGQPV
PMDCVFTLSAGATLKLGAVSGAGVRSYLCLSGGIQVPTYLGSKSTFTLGQFGGHAGRALR
SGDVLHLAPQTATEAGAALPEALRTDLPQIRTLRVIYGPHGAPEFFAPDYIATFFATEWE
VHFNSSRTGVRLIGPKPIWSRDSGGEAGLHPSNIHDNPYAVGAVDFTGDMPVILGPDGPS
LGGFVCPVTVIEADLWQLGQLKAGDKVRFTSVDLTTARQLAKARGQELATLCGQVTAWQP
APLTSPIVMTCGEADKRLVARLSGDTHLLLEAGEPELDLVLRFRIHALMQALEAHAKDGV
IDITPGIRSLQIHFQPEILTHDALLDWVRGEWLRVCLSDDLQVPTRVVHLPLSWDDPACR
QAIEKYMTTVRPDAPWCPSNLEFIRRINDLPDEQAVWETVFEASYLVMGLGDVYLGAPVA
TPLDPRHRLVTTKYNPARTWTAENSVGIGGAYLCVYGMEGPGGYQFVGRTLQMWNRYREV
ADFAGKPWLLRFFDQLRFYPVSAEELVQIRRDFPLGRYPLRIEPSTLRLSDYQQFLAHEA
QSIAAFRDHQQQAFNAERDRWITSGQAHFDSQENVAEEGGDAPLQQGEQGVESPVSGNLW
QVQTTVGSRVQAGDVLVVLESMKMEIPLLAPCDGIIQQVNVQPGSAVRAGQRVAVIVEDN
T
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataccttactgattgctaaccgcggtgcgatcgcctgccgcatcttgcgcacc
ctgcgcgccatgcaggtcaagggggtggctgtctatgccgaggccgatctgggcagcctg
catattcgtgatgccgatgaagcgttgtcccttggcgacggcccggcggcacaaacgtat
ctggccgctgaaaaaattattgccgcagcgcagcaaagcggtgcacaggcgattcacccg
ggctacggttttctctctgaaaacgccgggttcgctgaggcctgcgaggccgcagggctg
atttttgttggcccaacgccacagcagttgcggacttttggtctgaagcacacggcccgt
gctctggcgaaagctgaaggtgtgcccttgctggaaggcagcgagttactggccgatgcc
gccgaagcctgccgcgtcgccgagaccgttggttatccggtgatgctgaaaagtacggcg
ggtggcggcgggattggcatgcgcgtttgtcgcgattcgcatgaactgacggaagcgttt
gataccgtgcagcggctggggcagaacaactttagtgatgccggcgtgtttcttgagaac
tatatcgaacgcgcacgtcatcttgaggtgcagatctttggtgacgggcaaggagacgtt
atcgcgctgggcgtgcgtgactgctcggtgcagcggcgtaaccagaaggtcatcgaagaa
acacctgcccccaatttgcctgaaggcatggcacaggcgctctgcgaggcggcagttgcg
ctgggtaaagcagtgaactatcgcagcgcgggcaccgtggagtttgtctatgacagcctg
aaccaacaattttacttcctggaggtcaacactcgccttcaggtcgagcatggcgtaaca
gaacaggtctggggcgttgacctggtgaaatggatgattgaactggctgcggacaccttg
ccgcccctgcgcgagctggctgccgggcttgcgccacaaggccatgctatccaggcacgc
atttatgcggaagatccgggacggcagtttcagccttcaccgggcctgctgacagacgtt
gcctttcccgaccaacaggatgctcgcctgcgcattgatcactggattgaagccggttgc
gaagtgccgcccttttttgatccgctgctggcgaaaacgatcgcctggcggcccagccgc
ccggaggccattgccacactggcgcaggcgctggcagaaacgcgtttatacggtgttgaa
accaaccgcctctatctgcagcaaattttagcgtttgcgccctttgttcagggagaaccc
tggacccgttgtctggaacagctgagctatcaggcagcgacggttgaggtgctaggcgcc
ggtacgcaaaccagcgtgcaggattatccgggccgtctgggctactgggcggtcggcgta
ccgccatcggggccgatggacgaccgcgccctgcgttcaggcaatcggctgctgggcaat
gacgagggggaagccgcactggaaatgaccctcaccggacccactctgaaattcaatacc
gccatccaggccgtcatctgcggtgcaccactgagcgctaccctggatggccagcccgtg
ccgatggattgtgtttttaccctttccgccggggcgacgttaaagctgggtgctgtgagt
ggggcgggcgtgcgaagctatctctgcctgagcggcggcattcaggtgccaacgtattta
ggcagtaaaagcacctttacgcttggccagtttggcggccacgccggacgcgcactgcgt
agcggcgatgtgctgcacctggccccacagacagcaacggaagctggcgcggcacttcct
gaggcattgcgcacggatctcccgcagatccgcaccctacgggtaatttatggtccacac
ggtgcgccggagttcttcgcgccggactatatcgccactttttttgccacggaatgggaa
gtgcattttaactccagccgcacgggcgtccgcctgattgggcccaagcccatctggagc
cgagacagcgggggcgaagccggactgcatccgtcaaacattcacgacaatccgtacgcg
gtaggtgcggttgattttaccggcgatatgccggtgattctgggcccggatggacccagc
ctcgggggattcgtttgtccggtcactgtcatcgaagccgatctctggcagttagggcag
ttgaaagccggtgataaagtgcgctttacctcggtggatttaaccaccgcgcgccagttg
gctaaagcgcgaggccaggaactggcaacgctctgtggccaggtgacagcctggcaacct
gcgccgctgacctcgccgatcgtgatgacctgcggtgaggccgataagcgcctggtcgcg
cgactttctggcgatacgcatctgctactcgaagccggggagccggagctggatctggtt
ctgcgttttcgcattcatgccctgatgcaggcgctggaagcgcatgcaaaagacggggtg
attgatatcacgcccgggattcgttcgttgcagatccattttcagcctgaaatcctcacc
catgacgcgctgctggactgggtacgcggcgagtggctcagggtttgcctgagtgatgat
ctgcaggtgccaactcgcgtagtacatctgccgctttcctgggacgatcccgcctgtcgc
caggcgattgaaaagtacatgacgacggtacgccctgatgcaccgtggtgccccagtaac
cttgaattcattcgccgcattaacgatctgcctgacgaacaggcggtctgggagacggtg
tttgaggccagctatctggttatggggctgggcgatgtctatctgggggcgccggttgcg
acaccgctggatccgcgccatcgcctggtcaccacaaaatacaacccggcgcgcacctgg
acggcagagaactcggtgggtatcggcggcgcttacctctgcgtttacggcatggaaggc
cctggcggctatcagtttgtggggcgcacgcttcagatgtggaatcgctatcgagaggtt
gctgattttgcggggaaaccctggctactgcgcttctttgatcaactgcggttctaccct
gtatccgccgaggaactggtgcaaatccgccgcgatttcccgctggggcgttatccgctg
cgcattgagcccagtacgctgcggttgagtgattatcagcagtttctcgctcatgaggcg
caaagcatcgcggcgtttcgtgaccaccagcaacaggcgttcaatgcggaacgcgatcgc
tggatcaccagtggtcaggcccatttcgacagccaggagaacgtggcagaagagggcggt
gatgcaccgctacagcagggcgagcagggtgttgaaagcccggtttccggcaacctttgg
caagtgcaaaccacggtgggaagtcgggttcaggcgggggatgttctggtggtactggaa
tccatgaaaatggagattccgctgctggcaccatgcgatgggatcatccagcaggttaac
gtacagccaggcagtgccgtgcgcgccggacagcgggttgcggtgattgtggaggataac
acctga

DBGET integrated database retrieval system