KEGG   Pantoea ananatis LMG 20103: PANA_4158Help
Entry
PANA_4158         CDS       T01195                                 

Gene name
crtE
Definition
(GenBank) CrtE
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00900  Terpenoid backbone biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PANA_4158 (crtE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pam01006]
    PANA_4158 (crtE)
Enzymes [BR:pam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PANA_4158 (crtE)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PANA_4158 (crtE)
    2.5.1.29  geranylgeranyl diphosphate synthase
     PANA_4158 (crtE)
Prenyltransferases [BR:pam01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PANA_4158 (crtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt PTAC
Motif
Other DBs
NCBI-ProteinID: ADD79325
UniProt: D4GFK5
Position
4621111..4622046
Genome map
AA seq 311 aa AA seqDB search
MYPFIRTARMTVCAKKHVHLTRDAAEQLLADIDRRLDQLLPVEGERDVVGAAMREGALAP
GKRIRPMLLLLTARDLGCAVSHDGLLDLACAVEMVHAASLILDDMPCMDDAKLRRGRPTI
HSHYGEHVAILAAVALLSKAFGVIADADGLTPLAKNRAVSELSNAIGMQGLVQGQFKDLS
EGDKPRSAEAILMTNHFKTSTLFCASMQMASIVANASSEARDCLHRFSLDLGQAFQLLDD
LTDGMTDTGKDSNQDAGKSTLVNLLGPRAVEERLRQHLHLASEHLSAACQHGHATQHFIQ
AWFDKKLAAVS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgtttataaggacagcccgaatgacggtctgcgcaaaaaaacacgttcatctc
actcgcgatgctgcggagcagttactggctgatattgatcgacgccttgatcagttattg
cccgtggagggagaacgggatgttgtgggtgccgcgatgcgtgaaggtgcgctggcaccg
ggaaaacgtattcgccccatgttgctgttgctgaccgcccgcgatctgggttgcgctgtc
agccatgacggattactggatttggcctgtgcggtggaaatggtccacgcggcttcgctg
atccttgacgatatgccctgcatggacgatgcgaagctgcggcgcggacgccctaccatt
cattctcattacggagagcatgtggcaatactggcggcggttgccttgctgagtaaagcc
tttggcgtaattgccgatgcagatggcctcacgccgctggcaaaaaatcgggcggtttct
gaactgtcaaacgccatcggcatgcaaggattggttcagggtcagttcaaggatctgtct
gaaggggataagccgcgcagcgctgaagctattttgatgacgaatcactttaaaaccagc
acgctgttttgtgcctccatgcagatggcctcgattgttgcgaatgcctccagcgaagcg
cgtgattgcctgcatcgtttttcacttgatcttggtcaggcatttcaactgctggacgat
ttgaccgatggcatgaccgacaccggtaaggatagcaatcaggacgccggtaaatcgacg
ctggtcaatctgttaggccctagggcggttgaagaacgtctgagacaacatcttcatctt
gccagtgagcatctctctgcggcctgccaacacgggcacgccactcaacattttattcag
gcctggtttgacaaaaaactcgctgccgtcagttaa

DBGET integrated database retrieval system