KEGG   Pantoea ananatis LMG 20103: PANA_4160Help
Entry
PANA_4160         CDS       T01195                                 

Gene name
crtY
Definition
(GenBank) CrtY
  KO
K06443  lycopene beta-cyclase [EC:5.5.1.19]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00906  Carotenoid biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    PANA_4160 (crtY)
Enzymes [BR:pam01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.19  lycopene beta-cyclase
     PANA_4160 (crtY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lycopene_cycl NAD_binding_8 K_oxygenase Thi4
Motif
Other DBs
NCBI-ProteinID: ADD79327
UniProt: D4GFK7
Position
4623323..4624483
Genome map
AA seq 386 aa AA seqDB search
MGAAMQPHYDLILVGAGLANGLIALRLQQQQPDMRILLIDAAPQAGGNHTWSFHHDDLTE
SQHRWIASLVVHHWPDYQVRFPTRRRKLNSGYFCITSQRFAEVLQRQFGPHLWMDTAVAE
VNAESVRLKKGQVIGARAVIDGRGYAANSALSVGFQAFIGQEWRLSHPHGLSSPIIMDAT
VDQQNGYRFVYSLPLSPTRLLIEDTHYIDNATLDPERARQNICDYAAQQGWQLQTLLREE
QGALPITLSGNAEAFWQQRPLACSGLRAGLFHPTTGYSLPLAVAVADRLSALDVFTSASI
HQAIRHFARERWQQQRFFRMLNRMLFLAGPADSRWRVMQRFYGLPEDLIARFYAGKLTLT
DRLRILSGKPPVPVLAALQAIMTTHR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgggagcggctatgcaaccgcattatgatctgattctcgtgggggctggactcgcgaat
ggccttatcgccctgcgtcttcagcagcagcaacctgatatgcgtattttgcttatcgac
gccgcaccccaggcgggcgggaatcatacgtggtcatttcaccacgatgatttgactgag
agccaacatcgttggatagcttcgctggtggttcatcactggcccgactatcaggtacgc
tttcccacacgccgtcgtaagctgaacagcggctacttctgtattacttctcagcgtttc
gctgaggttttacagcgacagtttggcccgcacttgtggatggataccgcggtcgcagag
gttaatgcggaatctgttcggttgaaaaagggtcaggttatcggtgcccgcgcggtgatt
gacgggcggggttatgcggcaaactcagcactgagcgtgggcttccaggcgtttattggc
caggaatggcgattgagccacccgcatggtttatcgtctcccattatcatggatgccacg
gtcgatcagcaaaatggttatcgcttcgtgtacagcctgccgctctcgccgaccagattg
ttaattgaagacacgcactatatcgataatgcgacattagatcctgaacgcgcgcggcaa
aatatttgcgactatgccgcgcaacagggttggcagcttcagacattgctgcgtgaagaa
cagggcgccttacccatcaccctgtcgggcaatgccgaggcattctggcagcagcgcccc
ctggcctgtagtggattacgtgccggtctgttccatcctaccaccggctattcactgccg
ctggcggttgccgtggccgaccgcctgagcgcacttgatgtctttacgtcggcctcaatt
caccaggctattaggcattttgcccgcgagcgctggcagcagcagcgctttttccgcatg
ctgaatcgcatgctgtttttagccggacccgccgattcacgctggcgggttatgcagcgt
ttttatggtttacctgaagatttaattgcccgtttttatgcgggaaaactcacgctgacc
gatcggctacgtattctgagcggcaagccgcctgttccggtattagcagcattgcaagcc
attatgacgactcatcgttaa

DBGET integrated database retrieval system