KEGG   Pantoea ananatis LMG 20103: PANA_4163Help
Entry
PANA_4163         CDS       T01195                                 

Gene name
crtZ
Definition
(GenBank) CrtZ
  KO
K15746  beta-carotene 3-hydroxylase [EC:1.14.15.24]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00906  Carotenoid biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    PANA_4163 (crtZ)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.24  beta-carotene 3-hydroxylase
     PANA_4163 (crtZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_hydroxylase
Motif
Other DBs
NCBI-ProteinID: ADD79330
UniProt: D4GFL0
Position
complement(4626838..4627365)
Genome map
AA seq 175 aa AA seqDB search
MLWIWNALIVFVTVIGMEVVAALAHKYIMHGWGWGWHLSHHEPRKGAFEVNDLYAVVFAA
LSILLIYLGSTGMWPLQWIGAGMTAYGLLYFMVHDGLVHQRWPFRYIPRKGYLKRLYMAH
RMHHAVRGKEGCVSFGFLYAPPLSKLQATLRERHGARAGAARDAQGGEDEPASGK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggatttggaatgccctgatcgttttcgttaccgtgattggcatggaagtggtt
gctgcactggcacacaaatacatcatgcacggctggggttggggatggcatctttcacat
catgaaccgcgtaaaggtgcgtttgaagttaacgatctttatgctgtggtttttgctgca
ttatcgatcctgctgatttatctgggcagtacaggaatgtggccgctccagtggattggc
gcaggtatgacggcgtatggattactctattttatggtgcacgacgggctggtgcatcaa
cgttggccattccgctatattccacgcaagggctacctcaaacggttgtatatggcgcac
cgtatgcatcacgccgtcaggggcaaagaaggttgtgtttcttttggcttcctctatgcg
ccgcccctgtcaaaacttcaggcgacgctccgggaaagacatggcgctagagcgggcgct
gccagagatgcgcagggcggggaggatgagcccgcatccgggaagtaa

DBGET integrated database retrieval system