KEGG   Pseudomonas amygdali: BKM19_007760Help
Entry
BKM19_007760      CDS       T05354                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00480  Glutathione metabolism
pamg00590  Arachidonic acid metabolism
pamg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BKM19_007760
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKM19_007760
Enzymes [BR:pamg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BKM19_007760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVB13513
UniProt: A0A2G4CLU5
Position
1460656..1461144
Genome map
AA seq 162 aa AA seqDB search
MSAFHDIKLKALGGQELPMAGFKNKVVLVVNVASKCGLTPQYAALENLYQQYKDKGLEIL
GLPCNQFAGQEPGSEKEIAEFCELNYGVTFTLGEKLDVNGPDRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKNGGVSARFSPRTAPDDPAVIQAIEKALAQS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttttcacgacatcaaattgaaagcgctgggtggtcaggaactgccgatggcg
ggtttcaagaacaaagtggttctggtggtcaacgtcgcgtccaaatgcgggctgacaccg
caatacgcagcacttgaaaacctctatcagcaatacaaggacaagggcctggagattctc
gggctgccgtgcaaccagtttgccgggcaggaaccgggcagcgaaaaagagatcgccgaa
ttttgcgaactcaattacggcgtgacctttacgctgggtgaaaaactcgacgtcaatggc
cctgaccggcattcgctttatcgcctgctggctggcgaaggcgccgagtttcccggggat
atcacctggaatttcgaaaagtttctggtcggcaagaacggtggcgtgagcgcgcgtttc
tctccgcgtactgcaccggatgatcccgcagtgattcaggccattgaaaaggccttggca
caaagctga

DBGET integrated database retrieval system