KEGG   Pseudomonas amygdali: BKM19_014925Help
Entry
BKM19_014925      CDS       T05354                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00020  Citrate cycle (TCA cycle)
pamg00620  Pyruvate metabolism
pamg01100  Metabolic pathways
pamg01110  Biosynthesis of secondary metabolites
pamg01120  Microbial metabolism in diverse environments
pamg01200  Carbon metabolism
Module
pamg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pamg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM19_014925 (mqo)
   00620 Pyruvate metabolism
    BKM19_014925 (mqo)
Enzymes [BR:pamg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BKM19_014925 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AVB14735
UniProt: A0A2S4IVM0
Position
complement(3002323..3003978)
Genome map
AA seq 551 aa AA seqDB search
MDDRMFKKVNTALLGLAISMGLMPVQAAETKKVDVLLVGGGIMSATLAVWLNELEPSWSM
EMVERLDGVAEESSNGWNNAGIGHSALAELNYTPEDKNGNVDISKAIEINEAFQISRQFW
SWQVKTGVLKNPRSFINSTPHMSFVWGDNNIQFLRKRYAALQASPLFSGMQYSEDHEQIK
KWVPLMMEGRDPAQKLAVTWSPIGTDVNFGEITRQFVANLKAKQNFNLQLSSEVEDINHN
DDGTWRVKYKNLKDGTVTETDTKFLFIGAGGAALHLLQESGIPEAKEYGGFPVGGSWLVT
DNQTLAMQHMGKAYGIASTGAPPMSVPHLDTRVLDGKRVILFGPFATFSTKFLKNGSYFD
LLTSTTTHNVWPMTRVGIEQYPLIEYLAGQVMMSDDDRFAALQQYFPNAKKEDWRLMQAG
QRVQIIKRDEEKGGVLKLGTEIVASKDGSIAGLLGASPGASTAAPIMLGVLEKVFKDKVA
TPEWQAKLRQIVPSYGTKLNNNPDRVAEEWAYTAEVLQLTPPPPVNKTGNAPTPAPAAQP
AKSNPASDMAL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagaatgtttaaaaaagtgaacacggccctgctgggtctggccatttccatg
ggcctgatgcccgtgcaggcggctgaaaccaagaaagtcgacgtattgctcgtcggcggc
ggcatcatgagtgcaacgcttgcggtctggctcaacgagctggagccgagctggtcgatg
gaaatggtcgagcgcctcgatggcgtggccgaagaaagctccaacggctggaacaatgcc
ggtatcggccactcggccctggccgagctgaactacaccccggaagacaagaacggcaac
gttgatatctccaaggccatcgagatcaacgaagcgttccagatttcccgtcagttctgg
tcgtggcaggtcaagaccggcgttctgaagaacccgcgttcgttcatcaactccacgccg
cacatgagctttgtgtggggcgacaacaacatccagttcctgcgcaagcgttacgcagca
ttgcaggccagcccgctgttcagcggcatgcagtactccgaagaccacgagcagatcaag
aagtgggttccattgatgatggaaggtcgtgacccggcgcagaagctggctgtgacctgg
agcccgatcggcaccgacgtcaacttcggcgagatcacccgccagttcgtcgccaatctg
aaagccaagcagaatttcaatctgcagttgtcgagcgaagtcgaagacatcaatcacaac
gacgacggcacctggcgcgtcaagtacaagaacctgaaagacggtactgtcaccgagacc
gacaccaagttcctgttcatcggtgccggcggtgcagccctgcatctgctgcaggagtcc
ggtattcctgaagccaaggaatacggcggcttcccggtcggcggttcgtggcttgtcacc
gacaaccagactctggccatgcagcacatgggcaaggcctacggtatcgcgtcgactggc
gcgccacccatgtcggttccgcaccttgacacccgtgttctggatggcaagcgcgtgatc
ctgtttggcccgttcgcgaccttctcgaccaagttcctgaaaaacggctcctacttcgac
ctgctgaccagcaccaccacgcataacgtgtggccgatgactcgcgttggtatcgaacag
tacccgctgatcgaatacctggcaggtcaggtaatgatgtctgacgacgatcgcttcgcc
gctctgcagcagtacttcccgaacgccaagaaagaagactggcgcctgatgcaagccggt
cagcgcgtacagatcatcaagcgtgacgaagaaaaaggcggcgttctgaagctgggtacc
gaaatcgttgcttccaaggacggctccatcgccggtctgctgggcgcatcgccaggtgct
tcgactgcagcgccgatcatgctgggtgtgcttgagaaagtcttcaaggacaaggtagcg
actccggaatggcaggcaaagctgcgccagatcgtgcctagctatggcaccaagctgaac
aacaacccggatcgcgttgccgaggaatgggcttacacagccgaagtcctgcaactgact
ccaccgccgccggtgaacaagacaggtaatgctccaacacctgcacctgctgcacagcca
gcgaaaagcaatccagccagtgacatggcgctctaa

DBGET integrated database retrieval system