KEGG   Pseudomonas amygdali: BKM19_015945Help
Entry
BKM19_015945      CDS       T05354                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00860  Porphyrin and chlorophyll metabolism
pamg01100  Metabolic pathways
pamg01110  Biosynthesis of secondary metabolites
pamg01120  Microbial metabolism in diverse environments
Module
pamg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BKM19_015945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pamg01007]
    BKM19_015945
Enzymes [BR:pamg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BKM19_015945
Amino acid related enzymes [BR:pamg01007]
 Aminotransferase (transaminase)
  Class III
   BKM19_015945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AVB14911
UniProt: A0A2G4CWM9
Position
3233417..3234898
Genome map
AA seq 493 aa AA seqDB search
MNKPLDPASMPVIPESAVSQWPDVDSLYRRFDELVKQPIRPIKREAMSKVMGYFDERCQG
SKRLSEAAKKVIPGGVQHNLAFNYPFPLAFAQAKGAHLTDVDGNRYTDFLQAGGPTLLGS
NHPAIREQVNRILDECGPVTGLLHEYEVKLAELVCEVMPGVDMLRLLGSGTEAVMAAVRL
ARAYTRKKWVIKIGGAYHGWSDQLVYGMRLPGTGRMEAVGIPRGATANTQESPPNNLDAL
RRRLQINRLRGGTAAIMVEPFGPESGTRPVHADFNRQLRALCNEFGALLIFDEVVTGFRA
GLGGAQAYFNVMPDITVLGKCLTGGYPMAGAIGGRRDVMQLLAGGIGTSSRRAFVGGTLS
ANPLSCVAGYYALLEARRLNAPALAGRAGDRMRAGLDEIINRRGLPYVAYNMGSIVHLQT
SGVLLLDTSNPLKLLRARNEAKTRKHMMEEMGAAYTAHGLITLAGSRIYTSLADTDDVID
DALERFDAVFQLV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacctcttgatcctgccagcatgcctgtaattcccgaatcggctgtatcgcaa
tggccggacgtcgattccctctaccgccggttcgacgaactggtgaagcagcccattcgc
ccgatcaaacgcgaagcaatgagcaaggtcatgggctatttcgacgagcgctgtcagggc
tccaagcgtctttccgaggcagccaaaaaagtcataccgggaggtgtgcaacacaatctt
gcgttcaactatccgtttccgctggccttcgcccaggccaaaggtgcgcacctgacggat
gtcgacggcaaccgctacaccgattttctacaggcgggtggccccactttgttgggttcg
aatcacccggccattcgcgaacaggtcaaccgtattctcgatgaatgcgggccggtgacc
ggcttgctgcatgagtacgaggtcaagctcgccgaactggtctgtgaagtgatgcccggt
gtcgacatgctgcgcttgctgggctcgggcactgaagcggtgatggcagcggtacgcctg
gcacgcgcctacacccgcaagaagtgggtgattaaaatcggcggcgcctatcacggctgg
agcgatcaactggtctacggcatgcgcctgccgggtaccggtcgcatggaggcggtgggt
attccgcgaggtgccacggcaaacacccaggagagcccgcccaataatctggatgcatta
cgccgcaggctgcagatcaatcgccttcgtggcggcactgcagcgattatggtcgaaccc
tttggcccggaaagtggcacacgcccggtacacgccgacttcaaccgacagttgcgtgca
ctgtgtaacgaatttggcgcactgcttattttcgacgaagtagtcaccgggttccgtgcg
ggtctgggcggcgcacaagcttatttcaacgtcatgccggacatcacggtactgggtaaa
tgcctgacaggaggctacccgatggcgggtgccattggcggacgcagagatgtgatgcaa
ctgcttgccggtggcattggtacatcttcccgaagggcgttcgtaggagggacgctgtcg
gccaacccgctgtcgtgcgtcgccggttattacgcgctgctggaggcgcgccgcctgaat
gcgccggcgctagcgggcagggcgggcgaccgcatgcgcgcaggacttgatgaaatcatc
aatcgacgtggcttgccttatgttgcctacaacatgggctccatcgtgcatctgcagact
tccggtgtgctgctgctcgacaccagtaatccgctcaagctgctgagggctcgcaatgag
gccaagacccgcaagcacatgatggaggagatgggggctgcgtataccgctcatggcctg
atcaccctcgcgggcagccgtatctacaccagcctggcagacaccgacgacgtcattgat
gacgcgctcgagcggttcgacgccgtttttcaattggtgtga

DBGET integrated database retrieval system