KEGG   Pseudomonas amygdali: BKM19_016560Help
Entry
BKM19_016560      CDS       T05354                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00450  Selenocompound metabolism
pamg00970  Aminoacyl-tRNA biosynthesis
pamg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BKM19_016560
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKM19_016560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pamg01007]
    BKM19_016560
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pamg03016]
    BKM19_016560
Enzymes [BR:pamg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BKM19_016560
Amino acid related enzymes [BR:pamg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BKM19_016560
Transfer RNA biogenesis [BR:pamg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BKM19_016560
 Prokaryotic type
   Other AARSs
    BKM19_016560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f PolC_DP2
Motif
Other DBs
NCBI-ProteinID: AVB15012
UniProt: A0A2G4DGR0
Position
complement(3372712..3374211)
Genome map
AA seq 499 aa AA seqDB search
MSKYIVTITPPTPNGDLHIGHIAGPFLAADVFTRVQRQRGHDCVLVSYSDDYQSYMLRKG
LEQGVDPVELAGRNSDRIEASLAAINIKPDNWMRPHNNPWFAEAVGEVFNALREAGSIEF
RDSSEPYCPDCDVWGYEAFARGNCNYCGAESDASQCENCAQAPDAELMTGLHCKLCRQPS
QWKKAHRAFLKLADFKPHLRDRLLGQQWRKPLDNWLRDTLEHLHDWGVTRPGDGGLDLQA
DGSCRVHTWFMGLAGYMAAFREYADSVGRPELFRQYWQSGQGTLVHFLGFDCVFSHAIVY
PAQLSALRDIKVRQRFMPNQFLKLDGLNLSTSRNHAIWVGDLAREACADSARLYLASIAP
EQSEGDFRLTHFRAWREQIFDEFFPTLLDAGKHRDDNWWSGICGADAGLLEALRLQWSRA
AEPAQFSMKGMAQVLLDVIAIARARLAEGRPVSHLAAFIAVAGKALIPEMSAQIMTAFGL
PEARVNATLMNGSAAEYSI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtacatcgtgaccatcacgccgcccaccccgaatggcgatttgcacataggt
catatcgccggcccgtttctggccgctgacgtgttcacccgggtccagcgccagcgcggt
cacgactgtgtgctggtgtcctattccgacgattaccagtcctacatgctgcgcaaagga
ctggagcagggcgttgatccggtcgagctggccgggcgtaattccgaccgcatcgaagcg
tcgctggcggcgatcaacatcaagcccgacaactggatgcgtccgcacaacaacccatgg
tttgccgaggcggttggcgaggtgttcaacgcgttgcgtgaagcgggctcgatcgaattt
cgcgattccagcgagccgtactgccctgattgcgatgtgtggggctacgaggcatttgcc
cgaggcaactgcaattactgtggggccgagtctgatgccagccagtgcgagaactgcgct
caggcccctgacgccgagttgatgaccggtctgcactgcaaattgtgcagacagccgtcg
caatggaaaaaggcccatcgtgcatttctgaagctggctgatttcaagccgcacttgcgt
gatcgtctgttgggccagcaatggcgcaagccgctcgacaactggttgcgcgatacgctg
gagcacttgcatgactggggcgtaacccgtccgggcgacggcgggcttgacctgcaggcc
gacggttcgtgccgggtccacacctggttcatggggctggcgggctatatggcggcattt
cgtgaatatgccgacagtgtcgggcgtccggagctgttccgtcagtactggcagtcggga
cagggcacgctggtgcattttcttggttttgactgcgtgttcagccacgccatcgtctac
ccggcgcagctgtcggcgctgcgcgatatcaaagttcgccagcgcttcatgcccaatcag
tttctgaaactggacggcctgaacctgtcgaccagccgcaatcatgcgatctgggtcggc
gatctggcccgtgaagcctgtgccgacagtgcgcgcctgtatctggcaagcatcgcaccc
gagcaaagcgaaggcgattttcgtctgacgcatttccgcgcatggcgggagcagatattc
gacgaattttttcccacgttgctggacgctggaaagcatcgagatgacaactggtggagc
ggtatctgtggggccgatgccgggctgttggaagcgttacgcctgcaatggagcagggct
gcagagcctgcgcagttctctatgaagggcatggctcaggtgctgctcgacgtcatcgcc
attgctcgcgcacgtctggccgaaggtcggcccgtcagccatctggcggcgttcatcgca
gtggctggcaaggcgctgattccggaaatgtcagcgcagatcatgaccgcattcggactg
cccgaagcccgggtcaacgccacgctcatgaacggctcggccgctgaatactccatctga

DBGET integrated database retrieval system