KEGG   Pseudomonas amygdali: BKM19_026930Help
Entry
BKM19_026930      CDS       T05354                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pamg  Pseudomonas amygdali
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BKM19_026930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AVB17557
UniProt: A0A2G4D970
Position
5502154..5502534
Genome map
AA seq 126 aa AA seqDB search
MPDSRYQVDVSVVTRFLSEQSQPEQNRFAFAYTITVHNNGKLPARLLSRHWVITDGDGHV
EEVRGEGVVGQQPLIEVGKSHTYSSGTVMTTRVGNMQGSYQMLAEDGKRFDAVIKPFRLA
VPGSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgattctcgttaccaggtcgacgtcagcgtcgtcacacgctttctctcggaacag
tcgcaacccgagcagaatcgcttcgctttcgcctataccatcaccgtgcacaacaacggt
aaattacctgccaggctgctgtcgcgtcactgggtcatcaccgacggcgacggccatgtc
gaagaggtgcgcggcgagggcgtggtcggtcagcaaccgttgatcgaggtcggtaaaagc
catacctacagcagcggtacggtaatgaccacccgcgtgggcaatatgcagggttcttat
cagatgctggctgaagacggtaaacgctttgatgcggtcataaagccctttcgtctggcc
gtcccgggttcgctgcactga

DBGET integrated database retrieval system