KEGG   Pseudomonas amygdali: BKM19_029275Help
Entry
BKM19_029275      CDS       T05354                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00020  Citrate cycle (TCA cycle)
pamg00620  Pyruvate metabolism
pamg01100  Metabolic pathways
pamg01120  Microbial metabolism in diverse environments
pamg01200  Carbon metabolism
pamg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM19_029275
   00620 Pyruvate metabolism
    BKM19_029275
Enzymes [BR:pamg01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BKM19_029275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AVB17194
UniProt: A0A0N1JUZ0
Position
complement(5998073..5999488)
Genome map
AA seq 471 aa AA seqDB search
MITKILIANRGEIAVRIVRACAEMGIRSVAIFSDADRHALHVKRADEAYSIGAEPLAGYL
NPRKLVNLAVETGCDALHPGYGFLSENAELADICAERGIKFIGPSAEVIRRMGDKTEARR
SMIKAGVPVTPGTEGNVADIDEALVEGERIGYPVMLKATSGGGGRGIRRCNSREELEQAF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFGNVVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLSVRAAKAVGYENAGTVEFLLAEGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGLPLSIKQEDIIHRGFALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPFYDSMCLKLIVWALTWEEAMDRGLRALDDMRLQGVKTTAAYY
QEILRNPEFRSGEFNTSFVESHPELTNYSIKRKPEELALAIAAAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgataacaaaaattctgatcgccaaccgcggggagattgccgtccggatcgtgcgtgcc
tgcgccgagatgggtattcgctcggtcgcgatcttttccgatgccgaccggcatgccctg
catgtcaagcgtgctgacgaagcctatagcattggtgccgaaccgttggccggttacctg
aacccgcgcaagctggtgaatctggcggtagagactggctgcgatgcgctgcatcccggt
tatggctttctgtcggagaacgccgagctggccgacatctgtgctgaacgtggcattaag
tttatcggtccgtccgcagaagtgattcgtcgcatgggtgacaagaccgaagcgcggcgc
agcatgatcaaggccggtgtgccggttacgcccggcaccgaaggcaacgtcgcggacatc
gacgaggcgctggtcgaaggcgagcgtattggttacccggtaatgctcaaggccacctcc
ggcggcggcgggcgcggcatacgccgttgcaacagtcgcgaagaactcgagcaggccttc
ccccgggtgatttccgaagcaaccaaggcctttggctcggcggaagtgtttctcgagaag
tgcatcgtcaatcccaagcacatcgaagcgcagattctgggtgacagcttcggcaatgtg
gtgcacctgttcgagcgcgactgctcgattcagcgccgtaaccagaagctcatcgaaatc
gcccccagcccgcaactgactcccgagcagcgtgcttatatcggtgatctgtcggtgcgt
gcggccaaggctgtcggttacgagaacgcagggaccgtggagtttttgctcgccgagggc
gaggtgtacttcatggaaatgaatacccgggttcaggtcgagcacaccatcaccgaagaa
atcaccggcatcgatattgttcgcgagcagatccgtattgcgtccggcctgccgctgtcg
atcaagcaggaagacatcattcaccgcggttttgccctgcaattccggatcaatgccgaa
gacccgaagaacaacttcctgcccagtttcggcaagatcacccgctattacgcgcccgga
ggaccaggcgtgcgcaccgatacggcgatttacaccggctacaccattccgccgttttac
gactcgatgtgcctgaagctgatcgtctgggcgctgacctgggaggaggcgatggaccgt
ggcctgcgtgcgctggatgacatgcgcctgcaaggagtgaagaccacggctgcctattac
caggaaattctgcgtaacccggaatttcgcagcggtgaattcaacaccagctttgtcgag
agccaccccgagctgaccaattattcgatcaagcgcaaacccgaagagctggctctggcc
atcgccgccgccattgccgcacacgccggtctgtaa

DBGET integrated database retrieval system