KEGG   Paracoccus aminophilus: JCM7686_0515Help
Entry
JCM7686_0515      CDS       T02792                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase, PhbA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pami  Paracoccus aminophilus
Pathway
pami00071  Fatty acid degradation
pami00072  Synthesis and degradation of ketone bodies
pami00280  Valine, leucine and isoleucine degradation
pami00310  Lysine degradation
pami00362  Benzoate degradation
pami00380  Tryptophan metabolism
pami00620  Pyruvate metabolism
pami00630  Glyoxylate and dicarboxylate metabolism
pami00640  Propanoate metabolism
pami00650  Butanoate metabolism
pami00900  Terpenoid backbone biosynthesis
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
pami01120  Microbial metabolism in diverse environments
pami01130  Biosynthesis of antibiotics
pami01200  Carbon metabolism
pami01212  Fatty acid metabolism
pami02020  Two-component system
Module
pami_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JCM7686_0515
   00630 Glyoxylate and dicarboxylate metabolism
    JCM7686_0515
   00640 Propanoate metabolism
    JCM7686_0515
   00650 Butanoate metabolism
    JCM7686_0515
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JCM7686_0515
   00072 Synthesis and degradation of ketone bodies
    JCM7686_0515
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JCM7686_0515
   00310 Lysine degradation
    JCM7686_0515
   00380 Tryptophan metabolism
    JCM7686_0515
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JCM7686_0515
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JCM7686_0515
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JCM7686_0515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pami04147]
    JCM7686_0515
Enzymes [BR:pami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JCM7686_0515
Exosome [BR:pami04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JCM7686_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGT07624
UniProt: S5XKA6
Position
complement(464153..465328)
Genome map
AA seq 391 aa AA seqDB search
MTKAVIVSAARTPVGSFMGAFAHIPAHELGATVLRAVVERAGIDPSEVSETILGQVLTAA
QGQNPARQAHIKAGLPKESAAWLINQVCGSGLRSVALAAQQVILGDATIVAAGGQESMSL
STHAAYLRSGQKMGDMQLIDTMIRDGLWDAFNNYHMGQTAENVANQWQISRDEQDHFAVA
SQNKAEAAQKAGKFADEIVPHIVKTKKSEISVDADEYIRHGATLEAMEKLRPAFTKEGSV
TAGNASGLNDGAAAVLVMTEDEAARRGLTPLARIASYATAGLDPAIMGTGPIPASRKALE
KAGWKVADLDLVEANEAFAAQACAVNKELGWDPAIVNVNGGAIAIGHPIGASGARILNTL
LYEMKRRDAKKGLATLCIGGGMGVAMCLERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggccgtcatcgtctctgctgcgcgcacccctgtgggcagctttatgggggcg
ttcgcgcatatccccgcccacgagcttggtgcgaccgtccttcgcgccgtggtcgagcgc
gccggcatcgatccgtccgaagtcagcgaaaccatcctcggccaggtcctgacggccgca
caaggccagaacccggcccggcaggcgcatatcaaggccgggcttcccaaggaatcggcc
gcctggctgatcaatcaggtctgcggctcgggcctgcgcagcgtggcgcttgccgcgcag
caggtcattctgggcgatgcaacgatcgtcgccgcgggcggtcaggaatcgatgtcgctt
tcgacccatgccgcctatctgcgctcgggccagaagatgggcgacatgcagctcatcgac
acgatgatccgcgacggcctgtgggatgcgttcaacaactaccacatgggccagaccgcc
gaaaacgtcgccaatcaatggcagatctcgcgcgatgagcaggaccatttcgcggtcgca
tcgcaaaacaaggccgaggccgcgcagaaggccgggaaattcgccgatgagatcgtgccc
catattgtgaagaccaagaaatccgagatcagcgtcgatgccgacgaatatatccgtcac
ggcgccacgctcgaggccatggaaaagctgcgcccggccttcaccaaagagggctcggtc
acggcaggcaatgcctcgggcctgaatgacggtgccgcggcggttctggtgatgaccgag
gacgaggccgcgcgccgtgggctgacgccgcttgcgcgcatcgcctcttatgcgaccgcc
gggcttgatcccgccatcatgggcaccggcccgatcccggccagccgcaaggcactggaa
aaggcaggctggaaggtcgcggatcttgatctcgtcgaagccaacgaggcttttgccgca
caggcctgcgccgtcaacaaagagctcggctgggatccggcgatcgtgaacgtgaacggc
ggcgccattgccatcggccacccgatcggcgcttcgggcgcgcgcattctcaacaccctg
ctgtacgaaatgaagcgccgcgacgccaagaaaggcctcgcaaccctgtgcatcggcggc
ggcatgggcgtcgccatgtgccttgagcgtccgtaa

DBGET integrated database retrieval system