KEGG   Paracoccus aminophilus: JCM7686_0928Help
Entry
JCM7686_0928      CDS       T02792                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pami  Paracoccus aminophilus
Pathway
pami00020  Citrate cycle (TCA cycle)
pami00620  Pyruvate metabolism
pami00650  Butanoate metabolism
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
pami01120  Microbial metabolism in diverse environments
pami01130  Biosynthesis of antibiotics
pami01200  Carbon metabolism
Module
pami_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pami_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JCM7686_0928
   00620 Pyruvate metabolism
    JCM7686_0928
   00650 Butanoate metabolism
    JCM7686_0928
Enzymes [BR:pami01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     JCM7686_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AGT08037
UniProt: S5XSD9
Position
887828..889363
Genome map
AA seq 511 aa AA seqDB search
MPPPDPEDGGLALPDYLDRIRHKGLRDLVVSADQAAALIKDGMVLGMSGFTRAGEAKAVP
LALAERAKREPLKVTLMTGASLGNDLDKTLAEAHVLSRRIPFQSDPALRRAINAGEVMFI
DQHLSETVEQLRTRQIPGVDLAIIEAVAITEEGGIIPTTSVGNSASFALLAPKVIVEINT
SQPLALEGMHDIFIPTYRPARMPVPVVSPQSRIGLPYIPIPPERIAAIVISQKHDSASNI
LEPDEDTRAIAGHLTEFFKHEVAQGRLTNQLAPLQAGIGTIANAVLHGLIDSPFHDLTMY
SEVLQDSTFDLFDSGKMVFASGSSLTLSPAKGASVMPRLAEYKSRLMLRPQEISNHPEVV
RRLGIIAINTALEFDIYGNVNSTHVMGTQMMNGIGGSGDFARNAFMSIFVTKSMAKGGRI
SSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARVIIENTVAPEWRDLLRDYSAR
ATERGGHTPHLLEEALSWHDQLRRTGTMKPE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgccacccccagatccagaggatggagggctcgctttgccagattatctcgaccgcatc
cggcacaagggattgcgcgatctcgtggtctccgcagatcaggcggcggcgcttatcaag
gacggcatggtccttggcatgagcgggttcacccgcgcgggcgaggccaaggccgtgccg
ttggcgttggccgagcgtgccaaacgcgagccgctgaaggtcacgctgatgaccggggcc
tcgcttggcaatgatctcgacaagactttggccgaggcgcatgtcctctcgcgccgcatc
cccttccagtccgacccggctttgcgccgcgcgatcaatgcgggcgaggtgatgttcatc
gaccagcatctctcggaaaccgtcgagcaattgcgcacccgccagatccccggcgtcgat
ctcgccatcatcgaggcggtcgcgatcaccgaagagggcggcatcatccccacgacctcg
gtcggcaattcggcgagcttcgcgcttttggccccgaaggtgatcgtcgagatcaacacc
agccagccgctggcgcttgaagggatgcatgacatcttcatcccgacctatcgccccgcg
cggatgccggtgccggtggtctcgccgcaaagccggatcgggctgccctatatcccgatc
ccgcccgagcggatcgcagccatcgtcatctcgcaaaagcacgacagcgcctcgaatatc
cttgaaccggacgaggacacccgcgcgattgcgggccatctgaccgagttcttcaagcac
gaggtcgcccaaggccgcctcaccaaccagctcgcgcccttgcaagccgggatcggcacg
attgccaatgcggtgctgcacgggctgatcgacagcccgttccacgacctgacgatgtat
tccgaggtcttgcaggattcgaccttcgatcttttcgacagcggcaagatggtctttgct
tcgggctcgtccctgacgctctcgcctgcgaagggcgcgagcgtcatgccgcgcctcgcc
gaatataaatcgcggctgatgctgcgcccgcaagagatctcgaaccatcccgaggtcgtg
cggcgtctgggcattatcgcgatcaacaccgcgctcgaattcgacatctatggcaatgtg
aactcgacccatgtcatgggcacgcagatgatgaacggcatcggcggctcgggcgatttc
gcgcgcaatgccttcatgtcgatcttcgtgacgaaatccatggccaagggtggcaggatt
tcctcggtggtgccgatggtcagccatgtcgatcacaccgagcatgatgtcgatattctg
gtgaccgagcaggggctggccgatctgcgcggactggcaccgcgtgagcgcgcgcgggtc
atcatcgaaaacaccgtcgccccggaatggcgcgaccttctgcgcgattattccgcgcgc
gcgaccgagcgtggcgggcatacgccgcatctgctcgaagaggctttgagctggcacgac
cagctccgccgcaccggcacgatgaagccggaatga

DBGET integrated database retrieval system